Symbol:
Rab1a
Name:
RAB1A, member RAS oncogene family
RGD ID:
619736
Description:
Enables GTP binding activity. Involved in endocytosis and vesicle transport along microtubule. Acts upstream of or within endoplasmic reticulum to Golgi vesicle-mediated transport. Located in several cellular components, including Golgi membrane; early endosome; and neuronal cell body. Is active in presynapse. Orthologous to human RAB1A (RAB1A, member RAS oncogene family); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ac2-048; Rab1; RAB1, member RAS oncogene family; Rab1r; ras-related protein; ras-related protein Rab-1A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAB1A (RAB1A, member RAS oncogene family) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rab1a (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rab1a (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAB1A (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAB1A (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rab1a (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAB1A (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAB1A (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rab1a (RAB1A, member RAS oncogene family) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RAB1B (RAB1B, member RAS oncogene family) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Rab1a (RAB1A, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RAB1A (RAB1A, member RAS oncogene family)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rab1aa (RAB1A, member RAS oncogene family a)
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
rab1ab (RAB1A, member RAS oncogene family b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
rab-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rab1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
YPT1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rab1a
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Rab1-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 98,623,582 - 98,648,766 (+) NCBI GRCr8 mRatBN7.2 14 94,422,219 - 94,448,799 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 94,415,275 - 94,448,248 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 98,769,042 - 98,794,089 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 100,009,313 - 100,034,363 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 96,476,690 - 96,501,729 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 104,475,082 - 104,500,176 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 104,475,082 - 104,501,020 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 104,208,420 - 104,235,377 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 100,973,039 - 101,027,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 100,992,249 - 101,047,101 (+) NCBI Celera 14 93,445,267 - 93,470,406 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rab1a Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RAB1A (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RAB1A mRNA CTD PMID:22079256 Rab1a Rat (1->4)-beta-D-glucan multiple interactions ISO Rab1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAB1A mRNA CTD PMID:36331819 Rab1a Rat 17alpha-ethynylestradiol affects expression ISO Rab1a (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RAB1A mRNA CTD PMID:17555576 Rab1a Rat 17alpha-ethynylestradiol increases expression ISO Rab1a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of RAB1A mRNA CTD PMID:17942748 Rab1a Rat 17beta-estradiol increases expression ISO Rab1a (Mus musculus) 6480464 Estradiol results in increased expression of RAB1A mRNA CTD PMID:39298647 Rab1a Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Rab1a (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Rab1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rab1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RAB1A mRNA CTD PMID:21570461 Rab1a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RAB1A mRNA CTD PMID:33387578 and PMID:34747641 Rab1a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rab1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RAB1A mRNA CTD PMID:27913140 Rab1a Rat 2,6-dimethoxyphenol multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of RAB1A protein CTD PMID:38598786 Rab1a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RAB1A mRNA CTD PMID:21346803 Rab1a Rat 2-bromohexadecanoic acid multiple interactions ISO RAB1A (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of RAB1A protein] CTD PMID:38195004 Rab1a Rat 2-hydroxypropanoic acid decreases expression ISO RAB1A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RAB1A mRNA CTD PMID:30851411 Rab1a Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of RAB1A mRNA CTD PMID:19162173 Rab1a Rat 4,4'-sulfonyldiphenol increases expression ISO Rab1a (Mus musculus) 6480464 bisphenol S results in increased expression of RAB1A mRNA CTD PMID:39298647 Rab1a Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RAB1A mRNA CTD PMID:30047161 Rab1a Rat all-trans-retinoic acid decreases expression ISO RAB1A (Homo sapiens) 6480464 Tretinoin results in decreased expression of RAB1A mRNA CTD PMID:15498508 Rab1a Rat all-trans-retinoic acid increases expression ISO RAB1A (Homo sapiens) 6480464 Tretinoin results in increased expression of RAB1A mRNA CTD PMID:33167477 Rab1a Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of RAB1A mRNA CTD PMID:30047161 Rab1a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RAB1A mRNA CTD PMID:16483693 Rab1a Rat aristolochic acid A decreases expression ISO RAB1A (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RAB1A mRNA CTD PMID:33212167 Rab1a Rat Aroclor 1254 decreases expression ISO Rab1a (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of RAB1A mRNA CTD PMID:23650126 Rab1a Rat arsenous acid increases expression ISO RAB1A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RAB1A mRNA CTD PMID:20458559 Rab1a Rat benzo[a]pyrene increases mutagenesis ISO RAB1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of RAB1A gene CTD PMID:25435355 Rab1a Rat benzo[a]pyrene decreases expression ISO RAB1A (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of RAB1A mRNA CTD PMID:20064835 Rab1a Rat benzo[a]pyrene diol epoxide I decreases expression ISO RAB1A (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Rab1a Rat beta-lapachone increases expression ISO RAB1A (Homo sapiens) 6480464 beta-lapachone results in increased expression of RAB1A mRNA CTD PMID:38218311 Rab1a Rat bis(2-ethylhexyl) phthalate increases expression ISO Rab1a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RAB1A mRNA CTD PMID:33754040 Rab1a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RAB1A mRNA CTD PMID:25181051 Rab1a Rat bisphenol A increases expression ISO RAB1A (Homo sapiens) 6480464 bisphenol A results in increased expression of RAB1A protein CTD PMID:34186270 Rab1a Rat bisphenol A decreases expression ISO RAB1A (Homo sapiens) 6480464 bisphenol A results in decreased expression of RAB1A protein CTD PMID:31675489 Rab1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RAB1A mRNA CTD PMID:34947998 Rab1a Rat bisphenol A affects expression ISO RAB1A (Homo sapiens) 6480464 bisphenol A affects the expression of RAB1A mRNA CTD PMID:30903817 Rab1a Rat bisphenol AF increases expression ISO RAB1A (Homo sapiens) 6480464 bisphenol AF results in increased expression of RAB1A protein CTD PMID:34186270 Rab1a Rat Bisphenol B increases expression ISO RAB1A (Homo sapiens) 6480464 bisphenol B results in increased expression of RAB1A protein CTD PMID:34186270 Rab1a Rat bisphenol F increases expression ISO Rab1a (Mus musculus) 6480464 bisphenol F results in increased expression of RAB1A mRNA CTD PMID:38685157 Rab1a Rat cadmium atom multiple interactions ISO RAB1A (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of RAB1A protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of RAB1A protein CTD PMID:38195004 Rab1a Rat cadmium dichloride multiple interactions ISO RAB1A (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of RAB1A protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of RAB1A protein CTD PMID:38195004 Rab1a Rat caffeine affects phosphorylation ISO RAB1A (Homo sapiens) 6480464 Caffeine affects the phosphorylation of RAB1A protein CTD PMID:35688186 Rab1a Rat carbon nanotube affects expression ISO RAB1A (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of RAB1A protein CTD PMID:22001959 Rab1a Rat carbon nanotube increases expression ISO Rab1a (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 more ... Rab1a Rat carbon nanotube decreases expression ISO RAB1A (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of RAB1A protein CTD PMID:22157353 Rab1a Rat choline multiple interactions ISO Rab1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RAB1A gene CTD PMID:20938992 Rab1a Rat clobetasol increases expression ISO Rab1a (Mus musculus) 6480464 Clobetasol results in increased expression of RAB1A mRNA CTD PMID:27462272 Rab1a Rat cobalt dichloride increases expression ISO RAB1A (Homo sapiens) 6480464 cobaltous chloride results in increased expression of RAB1A mRNA CTD PMID:19376846 Rab1a Rat copper(II) sulfate decreases expression ISO RAB1A (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RAB1A mRNA CTD PMID:19549813 Rab1a Rat cyclosporin A increases expression ISO RAB1A (Homo sapiens) 6480464 Cyclosporine results in increased expression of RAB1A mRNA CTD PMID:20106945 Rab1a Rat diarsenic trioxide increases expression ISO RAB1A (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of RAB1A mRNA CTD PMID:20458559 Rab1a Rat diazinon increases methylation ISO RAB1A (Homo sapiens) 6480464 Diazinon results in increased methylation of RAB1A gene CTD PMID:22964155 Rab1a Rat Dibutyl phosphate affects expression ISO RAB1A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RAB1A mRNA CTD PMID:37042841 Rab1a Rat dibutyl phthalate increases expression ISO Rab1a (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of RAB1A protein CTD PMID:34864091 Rab1a Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of RAB1A mRNA CTD PMID:18636392 Rab1a Rat dichlorine increases expression EXP 6480464 Chlorine results in increased expression of RAB1A mRNA CTD PMID:18636392 Rab1a Rat dicrotophos decreases expression ISO RAB1A (Homo sapiens) 6480464 dicrotophos results in decreased expression of RAB1A mRNA CTD PMID:28302478 Rab1a Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of RAB1A mRNA CTD PMID:16122865 Rab1a Rat diuron decreases expression ISO RAB1A (Homo sapiens) 6480464 Diuron results in decreased expression of RAB1A mRNA CTD PMID:35967413 Rab1a Rat ethanol affects splicing ISO Rab1a (Mus musculus) 6480464 Ethanol affects the splicing of RAB1A mRNA CTD PMID:30319688 Rab1a Rat fenthion decreases expression ISO Rab1a (Mus musculus) 6480464 Fenthion results in decreased expression of RAB1A mRNA CTD PMID:34813904 Rab1a Rat folic acid multiple interactions ISO Rab1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RAB1A gene CTD PMID:20938992 Rab1a Rat formaldehyde increases expression ISO RAB1A (Homo sapiens) 6480464 Formaldehyde results in increased expression of RAB1A mRNA CTD PMID:23649840 Rab1a Rat FR900359 affects phosphorylation ISO RAB1A (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RAB1A protein CTD PMID:37730182 Rab1a Rat furfural multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RAB1A protein CTD PMID:38598786 Rab1a Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RAB1A mRNA CTD PMID:22061828 Rab1a Rat graphite decreases expression ISO RAB1A (Homo sapiens) 6480464 Graphite results in decreased expression of RAB1A protein CTD PMID:22157353 Rab1a Rat hydralazine multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RAB1A mRNA CTD PMID:17183730 Rab1a Rat inulin multiple interactions ISO Rab1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RAB1A mRNA CTD PMID:36331819 Rab1a Rat isoprenaline increases expression ISO Rab1a (Mus musculus) 6480464 Isoproterenol results in increased expression of RAB1A mRNA CTD PMID:21335049 Rab1a Rat ivermectin decreases expression ISO RAB1A (Homo sapiens) 6480464 Ivermectin results in decreased expression of RAB1A protein CTD PMID:32959892 Rab1a Rat L-methionine multiple interactions ISO Rab1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of RAB1A gene CTD PMID:20938992 Rab1a Rat lead(0) affects splicing ISO RAB1A (Homo sapiens) 6480464 Lead affects the splicing of RAB1A mRNA CTD PMID:28903495 Rab1a Rat levonorgestrel multiple interactions ISO RAB1A (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of RAB1A mRNA CTD PMID:19074003 Rab1a Rat lipopolysaccharide multiple interactions ISO RAB1A (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of RAB1A mRNA CTD PMID:35877022 Rab1a Rat lovastatin decreases expression ISO Rab1a (Mus musculus) 6480464 Lovastatin results in decreased expression of RAB1A mRNA CTD PMID:20493250 Rab1a Rat methidathion decreases expression ISO Rab1a (Mus musculus) 6480464 methidathion results in decreased expression of RAB1A mRNA CTD PMID:34813904 Rab1a Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of RAB1A mRNA CTD PMID:30047161 Rab1a Rat methotrexate affects response to substance ISO RAB1A (Homo sapiens) 6480464 RAB1A protein affects the susceptibility to Methotrexate CTD PMID:16217747 Rab1a Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of RAB1A mRNA CTD PMID:18636392 Rab1a Rat paracetamol decreases expression ISO RAB1A (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RAB1A mRNA CTD PMID:21420995 Rab1a Rat paracetamol affects expression ISO Rab1a (Mus musculus) 6480464 Acetaminophen affects the expression of RAB1A mRNA CTD PMID:17562736 Rab1a Rat pentachlorophenol increases expression ISO Rab1a (Mus musculus) 6480464 Pentachlorophenol results in increased expression of RAB1A mRNA CTD PMID:23892564 Rab1a Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rab1a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RAB1A mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RAB1A mRNA CTD PMID:36331819 Rab1a Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RAB1A mRNA CTD PMID:15215175 Rab1a Rat piroxicam decreases expression ISO RAB1A (Homo sapiens) 6480464 Piroxicam results in decreased expression of RAB1A mRNA CTD PMID:21858171 Rab1a Rat potassium chromate decreases expression ISO RAB1A (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RAB1A mRNA CTD PMID:22079256 Rab1a Rat potassium chromate multiple interactions ISO RAB1A (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of RAB1A mRNA CTD PMID:22079256 Rab1a Rat rac-lactic acid decreases expression ISO RAB1A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of RAB1A mRNA CTD PMID:30851411 Rab1a Rat resveratrol increases expression ISO Rab1a (Mus musculus) 6480464 resveratrol results in increased expression of RAB1A protein CTD PMID:25505154 Rab1a Rat resveratrol multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of RAB1A mRNA CTD PMID:23557933 Rab1a Rat rotenone increases expression ISO RAB1A (Homo sapiens) 6480464 Rotenone results in increased expression of RAB1A mRNA CTD PMID:33512557 Rab1a Rat sodium arsenite increases expression ISO RAB1A (Homo sapiens) 6480464 sodium arsenite results in increased expression of RAB1A mRNA CTD PMID:38568856 Rab1a Rat sodium chloride multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RAB1A protein more ... CTD PMID:38598786 Rab1a Rat sodium fluoride increases expression ISO Rab1a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of RAB1A protein CTD PMID:27548804 Rab1a Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of RAB1A mRNA CTD PMID:30047161 Rab1a Rat tamibarotene affects expression ISO RAB1A (Homo sapiens) 6480464 tamibarotene affects the expression of RAB1A mRNA CTD PMID:15498508 Rab1a Rat tamoxifen affects expression ISO Rab1a (Mus musculus) 6480464 Tamoxifen affects the expression of RAB1A mRNA CTD PMID:17555576 Rab1a Rat testosterone decreases expression ISO Rab1a (Mus musculus) 6480464 Testosterone deficiency results in decreased expression of RAB1A mRNA CTD PMID:33848595 Rab1a Rat testosterone undecanoate increases expression ISO RAB1A (Homo sapiens) 6480464 testosterone undecanoate results in increased expression of RAB1A mRNA CTD PMID:19074003 Rab1a Rat testosterone undecanoate multiple interactions ISO RAB1A (Homo sapiens) 6480464 [testosterone undecanoate co-treated with Levonorgestrel] results in increased expression of RAB1A mRNA CTD PMID:19074003 Rab1a Rat tetrachloromethane increases expression ISO Rab1a (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RAB1A mRNA CTD PMID:31919559 Rab1a Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of RAB1A protein CTD PMID:35544339 Rab1a Rat Tributyltin oxide decreases expression ISO Rab1a (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of RAB1A protein CTD PMID:19552622 Rab1a Rat triphenyl phosphate affects expression ISO RAB1A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RAB1A mRNA CTD PMID:37042841 Rab1a Rat valproic acid multiple interactions ISO RAB1A (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of RAB1A mRNA CTD PMID:17183730 Rab1a Rat valproic acid increases expression ISO RAB1A (Homo sapiens) 6480464 Valproic Acid results in increased expression of RAB1A mRNA CTD PMID:23179753 and PMID:27188386 Rab1a Rat valproic acid affects expression ISO Rab1a (Mus musculus) 6480464 Valproic Acid affects the expression of RAB1A mRNA CTD PMID:17292431 Rab1a Rat valproic acid affects expression ISO RAB1A (Homo sapiens) 6480464 Valproic Acid affects the expression of RAB1A mRNA CTD PMID:25979313 Rab1a Rat warfarin decreases expression ISO Rab1a (Mus musculus) 6480464 Warfarin results in decreased expression of RAB1A mRNA CTD PMID:20493250 Rab1a Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of RAB1A mRNA CTD PMID:12672911 Rab1a Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of RAB1A mRNA CTD PMID:12672911
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) choline (ISO) clobetasol (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dicrotophos (ISO) dimethylarsinic acid (EXP) diuron (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) graphite (ISO) hydralazine (ISO) inulin (ISO) isoprenaline (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) levonorgestrel (ISO) lipopolysaccharide (ISO) lovastatin (ISO) methidathion (ISO) methimazole (EXP) methotrexate (ISO) ozone (EXP) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (EXP) piroxicam (ISO) potassium chromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) tamibarotene (ISO) tamoxifen (ISO) testosterone (ISO) testosterone undecanoate (ISO) tetrachloromethane (ISO) thapsigargin (EXP) Tributyltin oxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) warfarin (ISO) zinc atom (EXP) zinc(0) (EXP)
Biological Process
autophagosome assembly (IBA,ISO,ISS) autophagy (IEA,ISO,ISS) cell migration (ISO,ISS) cilium assembly (ISO) COPII-coated vesicle cargo loading (ISO) defense response to bacterium (ISO,ISS) endocytosis (IMP,ISO) endoplasmic reticulum to Golgi vesicle-mediated transport (IDA,ISO) establishment of endothelial intestinal barrier (ISO) Golgi organization (ISO,ISS) growth hormone secretion (ISO,ISS) intracellular protein transport (IBA) melanosome transport (ISO) positive regulation of glycoprotein metabolic process (ISO) positive regulation of interleukin-8 production (ISO,ISS) protein transport (IEA) Rab protein signal transduction (IC) substrate adhesion-dependent cell spreading (ISO) vesicle transport along microtubule (IMP,ISO) vesicle-mediated transport (IEA)
1.
Molecular profiling of synaptic vesicle docking sites reveals novel proteins but few differences between glutamatergic and GABAergic synapses.
Boyken J, etal., Neuron. 2013 Apr 24;78(2):285-97. doi: 10.1016/j.neuron.2013.02.027.
2.
Rho proteins are localized with different membrane compartments involved in vesicular trafficking in anterior pituitary cells.
Cussac D, etal., Mol Cell Endocrinol. 1996 May 31;119(2):195-206.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
The organization of the endoplasmic reticulum and the intermediate compartment in cultured rat hippocampal neurons.
Krijnse-Locker J, etal., Mol Biol Cell. 1995 Oct;6(10):1315-32.
5.
Mammalian Bet3 functions as a cytosolic factor participating in transport from the ER to the Golgi apparatus.
Loh E, etal., J Cell Sci. 2005 Mar 15;118(Pt 6):1209-22. Epub 2005 Feb 22.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Proteomic analysis of endocytic vesicles: Rab1a regulates motility of early endocytic vesicles.
Mukhopadhyay A, etal., J Cell Sci. 2011 Mar 1;124(Pt 5):765-75. doi: 10.1242/jcs.079020. Epub 2011 Feb 8.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Quantitative analysis of synaptic vesicle Rabs uncovers distinct yet overlapping roles for Rab3a and Rab27b in Ca2+-triggered exocytosis.
Pavlos NJ, etal., J Neurosci. 2010 Oct 6;30(40):13441-53. doi: 10.1523/JNEUROSCI.0907-10.2010.
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Four additional members of the ras gene superfamily isolated by an oligonucleotide strategy: molecular cloning of YPT-related cDNAs from a rat brain library.
Touchot N, etal., Proc Natl Acad Sci U S A 1987 Dec;84(23):8210-4.
14.
Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.
Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
Rab1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 98,623,582 - 98,648,766 (+) NCBI GRCr8 mRatBN7.2 14 94,422,219 - 94,448,799 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 94,415,275 - 94,448,248 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 98,769,042 - 98,794,089 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 100,009,313 - 100,034,363 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 96,476,690 - 96,501,729 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 104,475,082 - 104,500,176 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 104,475,082 - 104,501,020 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 104,208,420 - 104,235,377 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 100,973,039 - 101,027,893 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 100,992,249 - 101,047,101 (+) NCBI Celera 14 93,445,267 - 93,470,406 (+) NCBI Celera Cytogenetic Map 14 q22 NCBI
RAB1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 65,086,854 - 65,130,106 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 65,070,696 - 65,130,331 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 65,313,988 - 65,357,240 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 65,167,493 - 65,210,793 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 65,225,639 - 65,268,940 NCBI Celera 2 65,160,375 - 65,204,151 (-) NCBI Celera Cytogenetic Map 2 p14 NCBI HuRef 2 65,047,966 - 65,091,371 (-) NCBI HuRef CHM1_1 2 65,244,946 - 65,288,425 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 65,096,482 - 65,139,769 (-) NCBI T2T-CHM13v2.0
Rab1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 20,151,412 - 20,176,856 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 20,151,432 - 20,176,856 (+) Ensembl GRCm39 Ensembl GRCm38 11 20,201,412 - 20,226,856 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 20,201,432 - 20,226,856 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 20,101,605 - 20,126,859 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 20,101,605 - 20,126,859 (+) NCBI MGSCv36 mm8 Celera 11 22,350,977 - 22,376,228 (+) NCBI Celera Cytogenetic Map 11 A3.1 NCBI cM Map 11 12.92 NCBI
Rab1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 19,393,589 - 19,421,373 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 19,393,589 - 19,421,373 (+) NCBI ChiLan1.0 ChiLan1.0
RAB1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 61,270,062 - 61,312,604 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 61,274,033 - 61,317,572 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 65,149,922 - 65,193,305 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 66,274,809 - 66,318,290 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 66,274,809 - 66,318,290 (-) Ensembl panpan1.1 panPan2
RAB1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 64,564,351 - 64,590,654 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 64,564,298 - 64,590,705 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 64,450,720 - 64,476,763 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 65,573,365 - 65,599,500 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 65,571,363 - 65,599,551 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 65,252,173 - 65,278,224 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 65,560,883 - 65,586,917 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 65,854,509 - 65,880,856 (-) NCBI UU_Cfam_GSD_1.0
Rab1a
RAB1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 76,837,430 - 76,869,778 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 76,837,673 - 76,868,156 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 80,675,435 - 80,712,268 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAB1A
Rab1a
.
Predicted Target Of
Count of predictions: 24 Count of miRNA genes: 21 Interacting mature miRNAs: 24 Transcripts: ENSRNOT00000021040 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582201 Sffal2 Serum free fatty acids level QTL 2 4 0.0002 blood free fatty acid amount (VT:0001553) serum free fatty acids level (CMO:0000547) 14 92553886 95876975 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 631213 Bw60 Body weight QTL60 4.51 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 79950921 95876975 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 4889951 Bss92 Bone structure and strength QTL 92 3.9 tibia area (VT:1000281) tibia-fibula cortical bone total cross-sectional area (CMO:0001721) 14 82057471 95876975 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat
RH139113
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 94,439,357 - 94,439,493 (+) MAPPER mRatBN7.2 Rnor_6.0 14 104,492,118 - 104,492,253 NCBI Rnor6.0 Rnor_5.0 14 104,226,906 - 104,227,041 UniSTS Rnor5.0 RGSC_v3.4 14 101,019,423 - 101,019,558 UniSTS RGSC3.4 Celera 14 93,462,356 - 93,462,491 UniSTS RH 3.4 Map 14 746.49 UniSTS Cytogenetic Map 14 q22 UniSTS
Rab1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 98,649,422 - 98,649,927 (+) Marker Load Pipeline RGSC_v3.4 1 31,669,138 - 31,669,640 UniSTS RGSC3.4 Celera 14 93,467,746 - 93,467,962 UniSTS Cytogenetic Map 14 q22 UniSTS
Rab1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 94,444,743 - 94,444,960 (+) MAPPER mRatBN7.2 Rnor_6.0 14 104,497,516 - 104,497,732 NCBI Rnor6.0 Rnor_5.0 14 104,232,717 - 104,232,933 UniSTS Rnor5.0 RGSC_v3.4 14 101,025,233 - 101,025,449 UniSTS RGSC3.4 Celera 14 93,467,746 - 93,467,962 UniSTS Cytogenetic Map 14 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021040 ⟹ ENSRNOP00000045598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,436,372 - 94,448,248 (+) Ensembl Rnor_6.0 Ensembl 14 104,489,103 - 104,501,020 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078710 ⟹ ENSRNOP00000072088
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,436,621 - 94,448,248 (+) Ensembl Rnor_6.0 Ensembl 14 104,480,662 - 104,501,017 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084481 ⟹ ENSRNOP00000073493
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,422,286 - 94,447,393 (+) Ensembl Rnor_6.0 Ensembl 14 104,475,082 - 104,500,173 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000098411 ⟹ ENSRNOP00000081304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,415,275 - 94,447,393 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103373 ⟹ ENSRNOP00000081611
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,415,275 - 94,446,786 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103721 ⟹ ENSRNOP00000080734
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,415,275 - 94,447,393 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107103 ⟹ ENSRNOP00000085984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,436,340 - 94,448,248 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112998 ⟹ ENSRNOP00000092933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 94,435,618 - 94,447,394 (+) Ensembl
RefSeq Acc Id:
NM_031090 ⟹ NP_112352
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 98,623,677 - 98,648,766 (+) NCBI mRatBN7.2 14 94,422,311 - 94,447,404 (+) NCBI Rnor_6.0 14 104,475,082 - 104,500,176 (+) NCBI Rnor_5.0 14 104,208,420 - 104,235,377 (+) NCBI RGSC_v3.4 14 100,973,039 - 101,027,893 (+) RGD Celera 14 93,445,267 - 93,470,406 (+) RGD
Sequence:
GAAGCGATCACTGAGTGGCGGCGGCTGCTGATTGTGTTCTAAGGGTCGGAGTGGGGTCGACGTTTGCTCTACCGGAACAGCTTAGCTCATTCCTCCCCTTCCATTACCCGTGGCGCGGAGGCTTGGGG
hide sequence
RefSeq Acc Id:
XM_039092486 ⟹ XP_038948414
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 98,623,582 - 98,648,766 (+) NCBI mRatBN7.2 14 94,422,219 - 94,448,799 (+) NCBI
RefSeq Acc Id:
NP_112352 ⟸ NM_031090
- UniProtKB:
P10536 (UniProtKB/Swiss-Prot), Q6NYB7 (UniProtKB/Swiss-Prot), A6JQ16 (UniProtKB/TrEMBL)
- Sequence:
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDL
hide sequence
Ensembl Acc Id:
ENSRNOP00000045598 ⟸ ENSRNOT00000021040
Ensembl Acc Id:
ENSRNOP00000073493 ⟸ ENSRNOT00000084481
Ensembl Acc Id:
ENSRNOP00000072088 ⟸ ENSRNOT00000078710
RefSeq Acc Id:
XP_038948414 ⟸ XM_039092486
- Peptide Label:
isoform X1
- UniProtKB:
A6JQ17 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000092933 ⟸ ENSRNOT00000112998
Ensembl Acc Id:
ENSRNOP00000081304 ⟸ ENSRNOT00000098411
Ensembl Acc Id:
ENSRNOP00000080734 ⟸ ENSRNOT00000103721
Ensembl Acc Id:
ENSRNOP00000081611 ⟸ ENSRNOT00000103373
Ensembl Acc Id:
ENSRNOP00000085984 ⟸ ENSRNOT00000107103
RGD ID: 13699508 Promoter ID: EPDNEW_R10032 Type: initiation region Name: Rab1a_1 Description: RAB1A, member RAS oncogene family SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 104,475,078 - 104,475,138 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-29
Rab1a
RAB1A, member RAS oncogene family
Rab1
RAB1, member RAS oncogene family
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Rab1
RAB1, member RAS oncogene family
ras-related protein
Name updated
1299863 APPROVED
2002-08-07
Rab1
ras-related protein
Symbol and Name status set to provisional
70820 PROVISIONAL
