Advanced Search (OLGA)

Gene: Gtf2b (general transcription factor IIB) Rattus norvegicus

Analyze

Symbol:

Gtf2b

Name:

general transcription factor IIB

RGD ID:

619735

Description:

Predicted to enable several functions, including RNA polymerase II core promoter sequence-specific DNA binding activity; RNA polymerase II general transcription initiation factor activity; and TBP-class protein binding activity. Predicted to be involved in several processes, including RNA polymerase II core complex assembly; meiotic sister chromatid cohesion; and transcription initiation at RNA polymerase II promoter. Predicted to be located in chromosome. Predicted to be part of transcription factor TFIID complex and transcription preinitiation complex. Predicted to be active in cell division site; germinal vesicle; and kinetochore. Orthologous to human GTF2B (general transcription factor IIB); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

general transcription factor TFIIB; RNA polymerase II alpha initiation factor; transcription initiation factor IIB

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTF2B (general transcription factor IIB)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GTF2B (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtf2b (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtf2b (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SUA7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TfIIB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ttb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ttb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtf2b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtf2b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	234,427,637 - 234,446,049 (+)	Ensembl				GRCr8
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	239,546,251 - 239,564,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,440,531 - 237,458,860 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,303,904 - 232,322,233 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,741 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	223,777,527 - 223,795,808 (+)	NCBI		Celera
RGSC_v3.1	2	240,864,081 - 240,882,390 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

caffeine (ISO)

chromium(6+) (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclophosphamide (EXP)

dicrotophos (ISO)

dimethyl sulfoxide (ISO)

disulfiram (ISO)

diuron (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

geraniol (ISO)

hydrogen peroxide (ISO)

isobutanol (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

nefazodone (EXP)

nickel sulfate (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulindac (EXP,ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromosome organization (IEA,ISO)

DNA-templated transcription (IEA)

DNA-templated transcription initiation (IBA,IEA)

gene expression (IEA,ISO)

meiotic sister chromatid cohesion (IEA,ISO)

protein acetylation (ISO,ISS)

RNA polymerase II core complex assembly (IBA,IEA,ISO,ISS)

RNA polymerase II preinitiation complex assembly (IBA,IEA,ISO,ISS)

spindle assembly (IEA,ISO)

transcription by RNA polymerase II (IEA,ISO,ISS)

transcription initiation at RNA polymerase II promoter (IEA,ISO,ISS)

transcription preinitiation complex assembly (IEA)

transcriptional start site selection at RNA polymerase II promoter (IBA,IEA,ISO,ISS)

viral transcription (IEA,ISO,ISS)

Cellular Component

cell division site (IEA,ISO)

chromosome (IEA,ISO,ISS)

condensed chromosome (IEA,ISO)

germinal vesicle (IEA,ISO)

kinetochore (IEA,ISO)

nuclear body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

protein-DNA complex (IEA,ISO,ISS)

RNA polymerase II transcription regulator complex (IEA,ISO)

transcription factor TFIID complex (IEA,ISO)

transcription preinitiation complex (IBA)

Molecular Function

acetyltransferase activity (IBA)

acyltransferase activity (IEA)

DNA binding (IEA,ISO)

DNA-binding transcription factor binding (IEA,ISO)

metal ion binding (IEA)

nuclear thyroid hormone receptor binding (IEA,ISO)

promoter-specific chromatin binding (IEA,ISO,ISS)

protein binding (ISO)

protein-lysine-acetyltransferase activity (IEA,ISO,ISS)

RNA polymerase II complex binding (IEA,ISO,ISS)

RNA polymerase II core promoter sequence-specific DNA binding (IBA,IEA,ISO,ISS)

RNA polymerase II general transcription initiation factor activity (IBA,IEA,ISO)

TBP-class protein binding (IBA,IEA,ISO)

transferase activity (IEA)

zinc ion binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Structural insights into transcription initiation by RNA polymerase II.	Grunberg S and Hahn S, Trends Biochem Sci. 2013 Dec;38(12):603-11. doi: 10.1016/j.tibs.2013.09.002. Epub 2013 Oct 11.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	RNA polymerase II initiation factor alpha from rat liver is almost identical to human TFIIB.	Tsuboi A, etal., Nucleic Acids Res 1992 Jun 25;20(12):3250.

Additional References at PubMed

PMID:1517211	PMID:1876184	PMID:3029109	PMID:7601352	PMID:7675079	PMID:8413225	PMID:8504927	PMID:8515820	PMID:8516312	PMID:8524305	PMID:8972203	PMID:9420329
PMID:9722567	PMID:9841876	PMID:10318856	PMID:10619841	PMID:10893273	PMID:11045620	PMID:12477932	PMID:12931194	PMID:14644612	PMID:15489334	PMID:16230532	PMID:17997859
PMID:18722179	PMID:22227519	PMID:22323595	PMID:22869340	PMID:23264107	PMID:24441171	PMID:27193682	PMID:29158257

Genomics

Comparative Map Data

Gtf2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	234,427,637 - 234,446,049 (+)	Ensembl				GRCr8
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	239,546,251 - 239,564,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,440,531 - 237,458,860 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,303,904 - 232,322,233 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,741 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	223,777,527 - 223,795,808 (+)	NCBI		Celera
RGSC_v3.1	2	240,864,081 - 240,882,390 (+)	NCBI
Cytogenetic Map	2	q44	NCBI

GTF2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	88,852,633 - 88,891,567 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	88,852,633 - 88,891,944 (-)	Ensembl			hg38	GRCh38
GRCh37	1	89,318,316 - 89,357,250 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	89,090,909 - 89,129,889 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	89,030,635 - 89,069,275	NCBI
Celera	1	87,564,104 - 87,603,098 (-)	NCBI		Celera
Cytogenetic Map	1	p22.2	NCBI
HuRef	1	87,435,703 - 87,474,719 (-)	NCBI		HuRef
CHM1_1	1	89,433,373 - 89,472,373 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	88,696,014 - 88,734,967 (-)	NCBI		T2T-CHM13v2.0

Gtf2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	142,471,008 - 142,489,367 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	142,470,806 - 142,489,367 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	142,765,247 - 142,783,606 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	142,765,045 - 142,783,606 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	142,428,211 - 142,446,570 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	142,702,633 - 142,720,992 (+)	NCBI		MGSCv36	mm8
Celera	3	149,197,374 - 149,215,676 (+)	NCBI		Celera
Cytogenetic Map	3	H1	NCBI
cM Map	3	66.69	NCBI

Gtf2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	5,420,584 - 5,447,148 (+)	Ensembl
ChiLan1.0	NW_004955423	5,420,795 - 5,447,148 (+)	NCBI	ChiLan1.0	ChiLan1.0

GTF2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	138,078,278 - 138,117,617 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	137,234,167 - 137,273,418 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	91,568,296 - 91,607,467 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	90,319,637 - 90,359,134 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	90,319,637 - 90,359,134 (-)	Ensembl			panPan2	panpan1.1

GTF2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	59,491,986 - 59,527,142 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	59,492,055 - 59,527,054 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	62,200,289 - 62,235,125 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	60,003,234 - 60,038,110 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	60,003,305 - 60,081,246 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	59,568,745 - 59,603,586 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	59,524,029 - 59,558,856 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	60,009,800 - 60,044,657 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gtf2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	99,258,716 - 99,290,490 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936732	148,369 - 183,067 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936732	148,702 - 178,992 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTF2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	127,522,870 - 127,561,135 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	127,522,802 - 127,559,605 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	139,747,986 - 139,784,762 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTF2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	44,527,150 - 44,566,398 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	44,527,599 - 44,566,424 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	73,339,911 - 73,378,634 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtf2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	8,686,537 - 8,723,399 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624742	8,687,002 - 8,721,505 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gtf2b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	17,955,417 - 17,974,088 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gtf2b
116 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	185
Count of miRNA genes:	141
Interacting mature miRNAs:	159
Transcripts:	ENSRNOT00000015032
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	210956252	251712708	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	219814164	239320906	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	214404877	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	214404877	251712708	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	218051934	251712708	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	214404877	251712708	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	214404877	251712708	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	221088977	243501206	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	214404877	251712708	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	223810546	243965570	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	220274283	249795005	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat

Markers in Region

BF389714

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,779,971 - 231,780,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,722,087 - 248,722,215	NCBI	Rnor6.0
Rnor_5.0	2	267,252,213 - 267,252,341	UniSTS	Rnor5.0
RGSC_v3.4	2	240,889,996 - 240,890,124	UniSTS	RGSC3.4
Celera	2	223,790,154 - 223,790,282	UniSTS
RH 3.4 Map	2	1581.3	UniSTS
Cytogenetic Map	2	q44	UniSTS

RH136605

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,785,304 - 231,785,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,727,420 - 248,727,583	NCBI	Rnor6.0
Rnor_5.0	2	267,257,546 - 267,257,709	UniSTS	Rnor5.0
RGSC_v3.4	2	240,895,329 - 240,895,492	UniSTS	RGSC3.4
Celera	2	223,795,487 - 223,795,650	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015032 ⟹ ENSRNOP00000015033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,433,582 - 234,446,049 (+)	Ensembl
mRatBN7.2 Ensembl	2	231,773,165 - 231,785,635 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,723,255 - 248,727,741 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089648 ⟹ ENSRNOP00000070077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,427,637 - 234,446,043 (+)	Ensembl
mRatBN7.2 Ensembl	2	231,779,762 - 231,785,635 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119389 ⟹ ENSRNOP00000093700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	234,427,705 - 234,446,031 (+)	Ensembl
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl

RefSeq Acc Id:

NM_031041 ⟹ NP_112303

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	RGD
Celera	2	223,777,527 - 223,795,808 (+)	RGD

Sequence:

show sequence

CGCGGCCGCCTTGAAGATGGCGTCGACCAGCCGTTTGGATGCTCTCCCACGAGTCACATGTCCC
AATCATCCAGATGCGATTTTAGTTGAGGACTACAGAGCTGGCGACATGATCTGTCCCGAATGCG
GCCTAGTTGTAGGGGACCGGGTTATTGATGTGGGGTCTGAATGGAGAACTTTCAGCAATGACAA
AGCAACGAAAGACCCATCTCGAGTTGGAGACTCTCAGAATCCTCTTCTGAGTGATGGAGATTTG
TCCACCATGATTGGCAAGGGTACAGGAGCGGCAAGTTTTGATGAATTTGGCAATTCTAAGTATC
AGAACCGGAGAACAATGAGCAGCTCTGATAGAGCTATGATGAACGCATTCAAGGAGATCACGAC
CATGGCAGACAGAATCAACCTCCCACGCAATATAGTTGATCGAACAAATAATTTATTCAAGCAA
GTATATGAGCAGAAGAGCCTGAAGGGAAGAGCTAATGATGCGATAGCTTCTGCTTGTCTGTACA
TCGCTTGTAGACAAGAAGGCGTTCCCAGGACATTTAAAGAAATATGTGCTGTGTCTCGAATCTC
TAAGAAAGAAATTGGCCGTTGTTTTAAACTGATTTTGAAAGCTTTGGAGACGAGCGTGGATCTG
ATCACAACTGGGGACTTCATGTCCAGGTTCTGCTCCAACCTTTGCCTCCCCAAGCAAGTGCAGA
TGGCAGCTACACACATAGCCCGCAAGGCTGTGGAGCTGGACTTGGTTCCTGGCAGGAGTCCTAT
CTCTGTGGCGGCAGCAGCTATTTACATGGCCTCCCAGGCTTCAGCTGAGAAGCGAACACAGAAA
GAAATCGGGGATATTGCTGGTGTTGCTGATGTTACAATCCGACAGTCCTACAGACTGATCTACC
CTCGGGCTCCAGATCTCTTCCCTTCAGACTTCAAGTTTGACACCCCAGTGGACAAATTACCCCA
GCTATAAGCTGAGGCAACTAAGTGTCACACTCTTAATGTACATGGAACTTTGTGCATAGCCACA
CAGTGCTGGTTGAGCCTTTAATGAGGAAAAAGGAGATGGTACGCATTCCACAGCTAAGTATTAT
TGCTTAGTCTTCTGTATGTATATAGTAGTGCGACATATTTAATGACTTAAATTTCTTACTGATT
CTGCTTTCTTTTTTAGTGATCTAGGAAACAGTATTTTGGAAGATATTAAAATATGTAATTCTCA
AATAAAATTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_112303	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85345	(Get FASTA)	NCBI Sequence Viewer
	CAA46766	(Get FASTA)	NCBI Sequence Viewer
	EDL82360	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070077
GenBank Protein	P62916	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112303 ⟸ NM_031041

- UniProtKB:

P62916 (UniProtKB/Swiss-Prot), A6HW74 (UniProtKB/TrEMBL), A0A0A0MXW7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDP
SRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRI
NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIG
RCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAA
AIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPSDFKFDTPVDKLPQL

hide sequence

Ensembl Acc Id:

ENSRNOP00000070077 ⟸ ENSRNOT00000089648

Ensembl Acc Id:

ENSRNOP00000015033 ⟸ ENSRNOT00000015032

Ensembl Acc Id:

ENSRNOP00000093700 ⟸ ENSRNOT00000119389

Protein Domains

Cyclin-like TFIIB-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62916-F1-model_v2	AlphaFold	P62916	1-316	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619735	AgrOrtholog
BioCyc Gene	G2FUF-50978	BioCyc
Ensembl Genes	ENSRNOG00000011135	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000089648	ENTREZGENE
Gene3D-CATH	2.20.25.10	UniProtKB/Swiss-Prot
	Cyclin-like	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7303747	IMAGE-MGC_LOAD
InterPro	Cyclin-like	UniProtKB/Swiss-Prot
	Cyclin-like_sf	UniProtKB/Swiss-Prot
	TFIIB	UniProtKB/Swiss-Prot
	TFIIB_CS	UniProtKB/Swiss-Prot
	TFIIB_cyclin	UniProtKB/Swiss-Prot
	Znf_TFIIB	UniProtKB/Swiss-Prot
KEGG Report	rno:81673	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105412	IMAGE-MGC_LOAD
NCBI Gene	81673	ENTREZGENE
PANTHER	PTHR11618	UniProtKB/Swiss-Prot
	TRANSCRIPTION INITIATION FACTOR IIB	UniProtKB/Swiss-Prot
Pfam	TF_Zn_Ribbon	UniProtKB/Swiss-Prot
	TFIIB	UniProtKB/Swiss-Prot
PhenoGen	Gtf2b	PhenoGen
PRINTS	TIFACTORIIB	UniProtKB/Swiss-Prot
PROSITE	TFIIB	UniProtKB/Swiss-Prot
	ZF_TFIIB	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011135	RatGTEx
SMART	CYCLIN	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47954	UniProtKB/Swiss-Prot
	Zinc beta-ribbon	UniProtKB/Swiss-Prot
UniProt	A0A0A0MXW7	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2JWZ8_RAT	UniProtKB/TrEMBL
	A0A8I6AXE6_RAT	UniProtKB/TrEMBL
	A6HW74	ENTREZGENE, UniProtKB/TrEMBL
	P62916	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P29053	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Gtf2b	general transcription factor IIB			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Gtf2b	general transcription factor IIB			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations