Advanced Search (OLGA)

Gene: Pla2g1b (phospholipase A2 group IB) Rattus norvegicus

Analyze

Symbol:

Pla2g1b

Name:

phospholipase A2 group IB

RGD ID:

61949

Description:

Enables calcium-dependent phospholipase A2 activity and signaling receptor binding activity. Involved in fatty acid biosynthetic process; phospholipid metabolic process; and positive regulation of cell population proliferation. Located in cell surface and secretory granule. Orthologous to human PLA2G1B (phospholipase A2 group IB); PARTICIPATES IN alpha-linolenic acid metabolic pathway; arachidonic acid metabolic pathway; ether lipid metabolic pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; phospholipase A2; phospholipase A2 group 1B; phospholipase A2 group IB pancreas; phospholipase A2, group 1B; phospholipase A2, group IB; phospholipase A2, group IB, pancreas

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLA2G1B (phospholipase A2 group IB)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pla2g1b (phospholipase A2, group IB, pancreas)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLA2G1B (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Pla2g1b (phospholipase A2 group IB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RIMBP2 (RIMS binding protein 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pla2g1b (phospholipase A2, group IB, pancreas)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PLA2G1B (phospholipase A2 group IB)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pla2g1b (phospholipase A2, group IB (pancreas))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14507	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	C07E3.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C07E3.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pla2g1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pla2g1b	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pla2g1bl	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pla2g1bl	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	Y69A2AL.2	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,802,939 - 46,813,693 (-)	Ensembl				GRCr8
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,309,232 - 42,318,815 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,922,891 - 42,932,482 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	41,983,439 - 41,993,027 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,765,520 - 42,775,233 (-)	NCBI		Celera
RGSC_v3.1	12	42,268,862 - 42,278,577 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Insulin Resistance (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

alpha-amanitin (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

calcium atom (ISO)

calcium(0) (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cycloheximide (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dimethylarsinic acid (ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

flavonoids (ISO)

genistein (EXP)

hydrazine (ISO)

irinotecan (EXP)

iron atom (EXP)

iron(0) (EXP)

lead diacetate (EXP,ISO)

N-methyl-4-phenylpyridinium (ISO)

nitrofen (EXP)

nitroglycerin (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (EXP)

paracetamol (ISO)

perfluorononanoic acid (ISO)

propanal (ISO)

pyrrolidine dithiocarbamate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

streptozocin (ISO)

sulfasalazine (ISO)

sulforaphane (ISO)

testosterone (EXP)

titanium dioxide (EXP)

trichloroethene (EXP)

triptonide (ISO)

vanadyl sulfate (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

arachidonate secretion (IEA,ISO)

cellular response to insulin stimulus (ISO,ISS)

fatty acid biosynthetic process (IDA,ISO)

innate immune response in mucosa (ISO)

intracellular signal transduction (ISO)

leukotriene biosynthetic process (ISO)

lipid catabolic process (IEA,ISO)

lipid metabolic process (IEA)

neutrophil chemotaxis (ISO)

neutrophil mediated immunity (ISO)

phosphatidylcholine metabolic process (IBA,ISO)

phosphatidylglycerol metabolic process (IBA,ISO,ISS)

phospholipid metabolic process (IEA)

positive regulation of calcium ion transport into cytosol (ISO)

positive regulation of cell population proliferation (IDA,ISO)

positive regulation of fibroblast proliferation (ISO)

positive regulation of immune response (ISO)

positive regulation of interleukin-8 production (ISO)

positive regulation of MAPK cascade (ISO)

positive regulation of podocyte apoptotic process (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of D-glucose import across plasma membrane (ISO,ISS)

regulation of interleukin-1 production (ISO)

Cellular Component

cell surface (IDA,ISO)

extracellular region (IEA,ISO)

extracellular space (ISO)

secretory granule (IDA)

Molecular Function

A2-type glycerophospholipase activity (IDA,IEA,ISO)

bile acid binding (ISO,ISS)

calcium ion binding (IBA,IEA,ISO)

calcium-dependent phospholipase A2 activity (IBA,ISO)

hydrolase activity (IEA)

metal ion binding (IEA)

phospholipid binding (IBA)

protein binding (ISO)

signaling receptor binding (IBA,IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alpha-linolenic acid metabolic pathway (IEA)

arachidonic acid metabolic pathway (IEA)

ether lipid metabolic pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

glycerophospholipid metabolic pathway (IEA)

gonadotropin-releasing hormone signaling pathway (IEA)

linoleic acid metabolic pathway (IEA)

long term depression (IEA)

mitogen activated protein kinase signaling pathway (IEA)

toxoplasmosis pathway (IEA)

vascular endothelial growth factor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Novel proliferative effect of phospholipase A2 in Swiss 3T3 cells via specific binding site.	Arita H, etal., J Biol Chem. 1991 Oct 15;266(29):19139-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Protection against diet-induced obesity and obesity- related insulin resistance in Group 1B PLA2-deficient mice.	Huggins KW, etal., Am J Physiol Endocrinol Metab 2002 Nov;283(5):E994-E1001.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Dog and rat pancreatic phospholipases A2: complete amino acid sequences deduced from complementary DNAs.	Ohara O, etal., J Biochem (Tokyo) 1986 Mar;99(3):733-9.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	Type IB secretory phospholipase A2 is contained in insulin secretory granules of pancreatic islet beta-cells and is co-secreted with insulin from glucose-stimulated islets.	Ramanadham S, etal., Biochim Biophys Acta. 1998 Feb 23;1390(3):301-12.
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Biosynthesis of anandamide and N-palmitoylethanolamine by sequential actions of phospholipase A2 and lysophospholipase D.	Sun YX, etal., Biochem J 2004 Jun 15;380(Pt 3):749-56.
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1420353	PMID:2909239	PMID:6501264	PMID:7060561	PMID:7721806	PMID:7925459	PMID:10066760	PMID:10531313	PMID:11830583	PMID:12860195	PMID:15528384	PMID:16005851
PMID:16392040	PMID:17434532	PMID:17603006	PMID:25335547

Genomics

Comparative Map Data

Pla2g1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	46,802,939 - 46,813,693 (-)	Ensembl				GRCr8
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	42,309,232 - 42,318,815 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	42,922,891 - 42,932,482 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	41,983,439 - 41,993,027 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	42,765,520 - 42,775,233 (-)	NCBI		Celera
RGSC_v3.1	12	42,268,862 - 42,278,577 (-)	NCBI
Cytogenetic Map	12	q16	NCBI

PLA2G1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	120,322,115 - 120,327,779 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	120,322,115 - 120,327,779 (-)	Ensembl			hg38	GRCh38
GRCh37	12	120,759,918 - 120,765,582 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	119,244,297 - 119,249,975 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	119,222,634 - 119,228,312	NCBI
Celera	12	120,393,029 - 120,398,697 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	117,768,236 - 117,773,905 (-)	NCBI		HuRef
CHM1_1	12	120,727,838 - 120,733,516 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	120,309,295 - 120,314,955 (-)	NCBI		T2T-CHM13v2.0

Pla2g1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	115,604,201 - 115,612,781 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	115,604,321 - 115,612,781 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	115,466,142 - 115,474,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	115,466,262 - 115,474,722 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	115,916,275 - 115,924,726 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	115,727,265 - 115,735,716 (+)	NCBI		MGSCv36	mm8
Celera	5	112,565,302 - 112,573,926 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	56.1	NCBI

Pla2g1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	11,308,643 - 11,316,254 (+)	Ensembl
ChiLan1.0	NW_004955455	11,308,848 - 11,316,245 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLA2G1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	128,383,401 - 128,390,125 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	128,379,778 - 128,386,493 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	117,896,729 - 117,900,946 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	121,270,082 - 121,275,740 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	121,270,082 - 121,275,740 (-)	Ensembl			panPan2	panpan1.1

PLA2G1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	16,248,417 - 16,257,163 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	16,248,409 - 16,257,178 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	16,252,273 - 16,261,019 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	16,515,905 - 16,524,689 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	16,515,897 - 16,524,704 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	16,476,786 - 16,485,567 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	16,553,497 - 16,562,238 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	16,594,969 - 16,603,767 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pla2g1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	146,109,953 - 146,118,171 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936668	610,716 - 616,982 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936668	608,848 - 616,982 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLA2G1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	40,314,520 - 40,322,315 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	40,314,520 - 40,322,315 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	42,821,332 - 42,829,127 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLA2G1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	115,670,353 - 115,677,003 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	115,670,344 - 115,677,080 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	129,426,080 - 129,433,036 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pla2g1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	13,322,675 - 13,329,926 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	13,322,095 - 13,329,928 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pla2g1b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	38,352,016 - 38,358,445 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	52
Interacting mature miRNAs:	53
Transcripts:	ENSRNOT00000001525
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

RH128935

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	41	118	85	84	55	25	55	5	209	80	104	50	72	29	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063271231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D00036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001525 ⟹ ENSRNOP00000001525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,802,939 - 46,813,693 (-)	Ensembl
mRatBN7.2 Ensembl	12	41,142,200 - 41,153,226 (-)	Ensembl
Rnor_6.0 Ensembl	12	46,879,343 - 46,889,082 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000139564 ⟹ ENSRNOP00000103014

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	46,802,939 - 46,812,951 (-)	Ensembl

RefSeq Acc Id:

NM_031585 ⟹ NP_113773

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,939 - 46,812,653 (-)	NCBI
mRatBN7.2	12	41,142,200 - 41,151,915 (-)	NCBI
Rnor_6.0	12	46,879,353 - 46,889,067 (-)	NCBI
Rnor_5.0	12	48,676,465 - 48,687,835 (-)	NCBI
RGSC_v3.4	12	42,405,475 - 42,415,189 (-)	RGD
Celera	12	42,765,520 - 42,775,233 (-)	RGD

Sequence:

show sequence

CCCTCGCCAAGATGAAACTCCTTCTGCTGGCTGCTTTGCTCACAGCAGGCGTTACTGCACACAG
CATCAGCACTCGGGCTGTGTGGCAGTTCCGCAATATGATCAAGTGCACCATCCCCGGGAGTGAT
CCCCTGAGGGAGTACAACAACTACGGCTGCTACTGTGGCTTGGGCGGCTCAGGCACCCCAGTGG
ACGACTTAGACAGGTGCTGCCAGACTCATGACCACTGCTACAATCAGGCCAAGAAGCTGGAAAG
CTGTAAATTCCTCATCGACAACCCCTACACCAACACGTACTCATACAAGTGCTCCGGGAACGTG
ATCACCTGCAGCGACAAAAACAACGACTGTGAGAGCTTCATCTGCAACTGTGACCGGCAGGCCG
CCATCTGTTTCTCCAAGGTCCCCTACAACAAGGAATACAAAGACCTTGACACCAAGAAACACTG
TTAGGCTGTCACCCCACTTCCTGTCTATGCCGTCCCCGCTCCCCTTGCTGTCTTATTTCTGCAC
CGCACCCTCTAATAAAGTACCAGCAGAAAG

hide sequence

RefSeq Acc Id:

XM_008769222 ⟹ XP_008767444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI
mRatBN7.2	12	41,142,193 - 41,151,967 (-)	NCBI
Rnor_6.0	12	46,879,346 - 46,890,234 (-)	NCBI

Sequence:

show sequence

CTGTCTCTGCTAGGCCGTGCCACCACTGCTGATTCGTGTTTGCTCTGCTGACTCTACCAAACTG
GGCTGCTGGTGTCACTGTGAGGGGTTTGTGAGTGGACCGAGCTGCCGCTGCTGACCTGTGAACT
GAACCGCTGGTTTCCTGACAACAAAGATGGGAGCTGCTCCAAAGAACCTTTCTAAACAGGCAAA
TCCCTCTGGATTGTTCCCTGATAGACCCAAGGCCAGCCCAGAGTGGCTAAGAGCAAAGCAAACA
GCCTTATCTCGGGAGAGTGGGGCCCCAGCTATAAAGAGGGAAAGTCACTTGAGTTCTTCCCTCG
CCCAAGATGAAACTCCTTCTGCTGGCTGCTTTGCTCACAGGCGTTACTGCACACAGCATCAGCA
CTCGGGCTGTGTGGCAGTTCCGCAATATGATCAAGTGCACCATCCCCGGGAGTGATCCCCTGAG
GGAGTACAACAACTACGGCTGCTACTGTGGCTTGGGCGGCTCAGGCACCCCAGTGGACGACTTA
GACAGGTGCTGCCAGACTCATGACCACTGCTACAATCAGGCCAAGAAGCTGGAAAGCTGTAAAT
TCCTCATCGACAACCCCTACACCAACACGTACTCATACAAGTGCTCCGGGAACGTGATCACCTG
CAGCGACAAAAACAACGACTGTGAGAGCTTCATCTGCAACTGTGACCGGCAGGCCGCCATCTGT
TTCTCCAAGGTCCCCTACAACAAGGAATACAAAGACCTTGACACCAAGAAACACTGTTAGGCTG
TCACCCCACTTCCTGTCTATGCCGTCCCCGCTCCCCTTGCTGTCTTATTTCTGCACCGCACCCT
CTAATAAAGTACCAGCAGAAAGAAAGAAA

hide sequence

RefSeq Acc Id:

XM_063271231 ⟹ XP_063127301

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	46,802,932 - 46,814,511 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_113773	(Get FASTA)	NCBI Sequence Viewer
	XP_008767444	(Get FASTA)	NCBI Sequence Viewer
	XP_063127301	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA00024	(Get FASTA)	NCBI Sequence Viewer
	EDM13878	(Get FASTA)	NCBI Sequence Viewer
	EDM13879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001525
GenBank Protein	P04055	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113773 ⟸ NM_031585
- Peptide Label:	precursor
- UniProtKB:	P04055 (UniProtKB/Swiss-Prot), A6J1T9 (UniProtKB/TrEMBL), A6J1U0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLD RCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICF SKVPYNKEYKDLDTKKHC hide sequence

RefSeq Acc Id:	XP_008767444 ⟸ XM_008769222
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2PYZ4 (UniProtKB/TrEMBL), A6J1U0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLLLLAALLTGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPVDDLDR CCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNCDRQAAICFS KVPYNKEYKDLDTKKHC hide sequence

Ensembl Acc Id:

ENSRNOP00000001525 ⟸ ENSRNOT00000001525

RefSeq Acc Id:	XP_063127301 ⟸ XM_063271231
- Peptide Label:	isoform X1
- UniProtKB:	P04055 (UniProtKB/Swiss-Prot), A6J1U0 (UniProtKB/TrEMBL), A6J1T9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000103014 ⟸ ENSRNOT00000139564

Protein Domains

Phospholipase A2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P04055-F1-model_v2	AlphaFold	P04055	1-146	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698689

Promoter ID:

EPDNEW_R9214

Type:

multiple initiation site

Name:

Pla2g1b_1

Description:

phospholipase A2 group IB

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	46,889,066 - 46,889,126	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61949	AgrOrtholog
BioCyc Gene	G2FUF-18994	BioCyc
BioCyc Pathway	PWY-7409 [phospholipid remodeling (phosphatidylethanolamine, yeast)]	BioCyc
	PWY-7416 [phospholipid remodeling (phosphatidylcholine, yeast)]	BioCyc
	PWY-7417 [phospholipid remodeling (phosphatidate, yeast)]	BioCyc
	PWY-7783 [plasmalogen degradation]	BioCyc
	PWY-8053 [anandamide biosynthesis II]	BioCyc
	PWY66-394 [aspirin triggered resolvin E biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7409	BioCyc
	PWY-7416	BioCyc
	PWY-7417	BioCyc
	PWY-7783	BioCyc
	PWY-8053	BioCyc
	PWY66-394	BioCyc
Ensembl Genes	ENSRNOG00000001153	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000001525	ENTREZGENE
Gene3D-CATH	1.20.90.10	UniProtKB/Swiss-Prot
InterPro	PLipase_A2	UniProtKB/Swiss-Prot
	PLipase_A2_Asp_AS	UniProtKB/Swiss-Prot
	PLipase_A2_dom	UniProtKB/Swiss-Prot
	PLipase_A2_dom_sf	UniProtKB/Swiss-Prot
	PLipase_A2_His_AS	UniProtKB/Swiss-Prot
KEGG Report	rno:29526	UniProtKB/Swiss-Prot
NCBI Gene	29526	ENTREZGENE
PANTHER	PHOSPHOLIPASE A2	UniProtKB/Swiss-Prot
	PTHR11716	UniProtKB/Swiss-Prot
Pfam	Phospholip_A2_1	UniProtKB/Swiss-Prot
PhenoGen	Pla2g1b	PhenoGen
PRINTS	PHPHLIPASEA2	UniProtKB/Swiss-Prot
PROSITE	PA2_ASP	UniProtKB/Swiss-Prot
	PA2_HIS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001153	RatGTEx
SMART	PA2c	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF48619	UniProtKB/Swiss-Prot
TIGR	TC218877
UniProt	A0A8L2PYZ4	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0L2I9_RAT	UniProtKB/TrEMBL
	A6J1T9	ENTREZGENE, UniProtKB/TrEMBL
	A6J1U0	ENTREZGENE, UniProtKB/TrEMBL
	P04055	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-30	Pla2g1b	phospholipase A2 group IB	Pla2g1b	phospholipase A2, group IB, pancreas	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-18	Pla2g1b	phospholipase A2, group IB, pancreas	Pla2g1b	phospholipase A2, group IB	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pla2g1b	phospholipase A2, group 1B			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Annotations - KEGG (archival)

BioCyc Pathways