Advanced Search (OLGA)

Gene: Stx6 (syntaxin 6) Rattus norvegicus

Analyze

Symbol:

Stx6

Name:

syntaxin 6

RGD ID:

61915

Description:

Predicted to enable SNAP receptor activity and syntaxin binding activity. Involved in endocytic recycling; retrograde transport, endosome to Golgi; and synaptic vesicle to endosome fusion. Located in recycling endosome and trans-Golgi network membrane. Is active in synaptic vesicle membrane. Orthologous to human STX6 (syntaxin 6); INTERACTS WITH 2-methoxyethanol; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC93348; Syn6; syntaxin-6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	STX6 (syntaxin 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Stx6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Stx6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	STX6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	STX6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Stx6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	STX6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	STX6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Stx6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Stx6 (syntaxin 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	STX10 (syntaxin 10)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Stx6 (syntaxin 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	STX6 (syntaxin 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stx6 (syntaxin 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	stx6 (syntaxin 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Syx6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Syx6	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TLG1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	TLG1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	syx-6	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	syx-6	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stx10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stx6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	stx6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	69,882,647 - 69,928,895 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	69,882,620 - 69,931,036 (+)	Ensembl				GRCr8
mRatBN7.2	13	67,332,329 - 67,378,580 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	67,332,314 - 67,378,576 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	69,917,560 - 69,963,589 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	71,231,256 - 71,277,146 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	68,491,771 - 68,538,463 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	72,804,218 - 72,850,757 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	72,804,218 - 72,852,967 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	77,739,763 - 77,785,254 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	70,121,864 - 70,169,379 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	67,207,720 - 67,253,510 (+)	NCBI		Celera
RGSC_v3.1	13	70,135,943 - 70,183,455 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

neuronal ceroid lipofuscinosis 6A (ISO)

progressive supranuclear palsy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methoxyethanol (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

coumarin (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dichlorine (EXP)

diquat (ISO)

endosulfan (EXP)

ethanol (ISO)

ethyl methanesulfonate (ISO)

flavonoids (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

genistein (EXP)

indole-3-methanol (EXP)

indometacin (ISO)

ivermectin (ISO)

kojic acid (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

nickel atom (ISO)

okadaic acid (ISO)

ozone (EXP)

paracetamol (ISO)

paraquat (EXP)

pinosylvin (ISO)

rotenone (ISO)

sarin (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trans-pinosylvin (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endocytic recycling (IDA,ISO)

endosome organization (IEA,ISO)

Golgi vesicle transport (IEA)

intracellular protein transport (IBA,IEA)

membrane fusion (IEA)

protein transport (IEA)

regulation of protein localization (IEA,ISO)

retrograde transport, endosome to Golgi (IBA,IDA,IEA,ISO)

synaptic vesicle to endosome fusion (IDA,IMP)

vesicle docking (IBA)

vesicle fusion (IBA,IEA,ISO)

vesicle-mediated transport (IDA,IEA)

Cellular Component

early endosome (IEA,ISO)

endomembrane system (IBA)

Golgi apparatus (IEA,ISO)

Golgi membrane (IEA)

membrane (IEA,ISO)

organelle membrane (IEA)

perinuclear region of cytoplasm (IEA,ISO)

phagocytic vesicle (ISO)

recycling endosome (IDA)

recycling endosome membrane (IEA)

SNARE complex (IBA,IEA,ISO)

synaptic vesicle membrane (EXP,IBA,IDA,IEP)

terminal bouton (HDA)

trans-Golgi network (IEA,ISO)

trans-Golgi network membrane (IDA,IEA,ISO)

vesicle (IEA)

Molecular Function

protein binding (IPI,ISO)

SNAP receptor activity (IBA,IEA)

SNARE binding (IBA)

syntaxin binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Synaptotagmin IV is necessary for the maturation of secretory granules in PC12 cells.	Ahras M, etal., J Cell Biol. 2006 Apr 24;173(2):241-51. Epub 2006 Apr 17.
2.	A new syntaxin family member implicated in targeting of intracellular transport vesicles.	Bock JB, etal., J Biol Chem 1996 Jul 26;271(30):17961-5.
3.	Syntaxin 6 functions in trans-Golgi network vesicle trafficking.	Bock JB, etal., Mol Biol Cell. 1997 Jul;8(7):1261-71.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	SNAREs define targeting specificity of trafficking vesicles by combinatorial interaction with tethering factors.	Koike S and Jahn R, Nat Commun. 2019 Apr 8;10(1):1608. doi: 10.1038/s41467-019-09617-9.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	A novel syntaxin 6-interacting protein, SHIP164, regulates syntaxin 6-dependent sorting from early endosomes.	Otto GP, etal., Traffic. 2010 May;11(5):688-705. doi: 10.1111/j.1600-0854.2010.01049.x.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Mammalian late vacuole protein sorting orthologues participate in early endosomal fusion and interact with the cytoskeleton.	Richardson SC, etal., Mol Biol Cell 2004 Mar;15(3):1197-210. Epub 2003 Dec 10.
13.	Evidence for early endosome-like fusion of recently endocytosed synaptic vesicles.	Rizzoli SO, etal., Traffic. 2006 Sep;7(9):1163-76.
14.	The Rab5 effector EEA1 interacts directly with syntaxin-6.	Simonsen A, etal., J Biol Chem. 1999 Oct 8;274(41):28857-60.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Molecular anatomy of a trafficking organelle.	Takamori S, etal., Cell. 2006 Nov 17;127(4):831-46.
17.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.

Additional References at PubMed

PMID:11384996	PMID:12082176	PMID:12857877	PMID:14622145	PMID:14742717	PMID:15489334	PMID:15689499	PMID:15800058	PMID:15886206	PMID:16154903	PMID:16428329	PMID:17003038
PMID:17003121	PMID:18406529	PMID:19224922	PMID:19338761	PMID:19620288	PMID:22190682	PMID:22783020	PMID:22871113	PMID:23485813	PMID:23677696	PMID:25799061

Genomics

Comparative Map Data

Stx6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	69,882,647 - 69,928,895 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	69,882,620 - 69,931,036 (+)	Ensembl				GRCr8
mRatBN7.2	13	67,332,329 - 67,378,580 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	67,332,314 - 67,378,576 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	69,917,560 - 69,963,589 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	71,231,256 - 71,277,146 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	68,491,771 - 68,538,463 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	72,804,218 - 72,850,757 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	72,804,218 - 72,852,967 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	77,739,763 - 77,785,254 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	70,121,864 - 70,169,379 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	67,207,720 - 67,253,510 (+)	NCBI		Celera
RGSC_v3.1	13	70,135,943 - 70,183,455 (+)	NCBI
Cytogenetic Map	13	q21	NCBI

STX6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	180,972,725 - 181,022,870 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	180,972,712 - 181,023,121 (-)	Ensembl			hg38	GRCh38
GRCh37	1	180,941,861 - 180,992,006 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	179,208,798 - 179,258,669 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	177,673,835 - 177,723,703	NCBI
Celera	1	154,049,189 - 154,099,059 (-)	NCBI		Celera
Cytogenetic Map	1	q25.3	NCBI
HuRef	1	152,173,031 - 152,222,901 (-)	NCBI		HuRef
CHM1_1	1	182,364,849 - 182,414,723 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	180,327,972 - 180,378,137 (-)	NCBI		T2T-CHM13v2.0

Stx6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	155,034,374 - 155,083,405 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	155,034,461 - 155,084,002 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	155,158,628 - 155,207,567 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	155,158,715 - 155,208,256 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	157,005,833 - 157,050,647 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	156,920,960 - 156,965,735 (+)	NCBI		MGSCv36	mm8
Celera	1	157,590,422 - 157,635,333 (+)	NCBI		Celera
Cytogenetic Map	1	G3	NCBI
cM Map	1	66.46	NCBI

Stx6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	20,048,155 - 20,089,906 (-)	Ensembl
ChiLan1.0	NW_004955406	20,042,552 - 20,089,853 (-)	NCBI	ChiLan1.0	ChiLan1.0

STX6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	68,748,337 - 68,798,313 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	68,406,649 - 68,456,600 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	156,450,202 - 156,500,143 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	160,117,825 - 160,167,314 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	160,117,825 - 160,167,314 (-)	Ensembl			panPan2	panpan1.1

STX6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	14,452,663 - 14,506,120 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	14,458,404 - 14,556,917 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	14,030,381 - 14,083,562 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	14,179,873 - 14,232,084 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	14,184,065 - 14,232,056 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	14,089,893 - 14,143,515 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	14,196,719 - 14,249,919 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	14,320,679 - 14,373,902 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Stx6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	90,515,308 - 90,558,479 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	8,362,050 - 8,399,737 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936481	8,362,059 - 8,405,228 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STX6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	122,529,727 - 122,580,608 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	122,533,737 - 122,580,631 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	134,569,941 - 134,616,721 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STX6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	48,380,359 - 48,427,279 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	48,397,712 - 48,426,676 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	49,763,242 - 49,813,281 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stx6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	1,227,052 - 1,265,158 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624771	1,222,809 - 1,264,662 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Stx6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	34,581,168 - 34,625,048 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Stx6
223 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	200
Count of miRNA genes:	134
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000035145
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	39968211	83286298	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37087983	82087983	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	26244808	71244808	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	33794096	78794096	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	39924693	84924693	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	34834947	79834947	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	39814726	84814726	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	39968211	84968211	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	26244808	71244808	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
11530006	Niddm72	Non-insulin dependent diabetes mellitus QTL 72		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	38286298	83286298	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

RH128466

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	67,378,267 - 67,378,483 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	72,850,445 - 72,850,660	NCBI	Rnor6.0
Rnor_5.0	13	77,784,942 - 77,785,157	UniSTS	Rnor5.0
RGSC_v3.4	13	70,169,067 - 70,169,282	UniSTS	RGSC3.4
Celera	13	67,253,198 - 67,253,413	UniSTS
RH 3.4 Map	13	359.3	UniSTS
Cytogenetic Map	13	q21	UniSTS

RH138891

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	67,340,810 - 67,341,016 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	72,812,688 - 72,812,893	NCBI	Rnor6.0
Rnor_5.0	13	77,748,233 - 77,748,438	UniSTS	Rnor5.0
RGSC_v3.4	13	70,130,344 - 70,130,549	UniSTS	RGSC3.4
Celera	13	67,216,183 - 67,216,388	UniSTS
RH 3.4 Map	13	353.9	UniSTS
Cytogenetic Map	13	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U56815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035145 ⟹ ENSRNOP00000037536

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	69,882,620 - 69,919,273 (+)	Ensembl
mRatBN7.2 Ensembl	13	67,332,314 - 67,368,957 (+)	Ensembl
Rnor_6.0 Ensembl	13	72,804,218 - 72,852,967 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099649 ⟹ ENSRNOP00000080858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	69,882,630 - 69,928,891 (+)	Ensembl
mRatBN7.2 Ensembl	13	67,332,329 - 67,378,576 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128442 ⟹ ENSRNOP00000103517

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	69,882,620 - 69,931,036 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000157101 ⟹ ENSRNOP00000109135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	69,896,977 - 69,928,891 (+)	Ensembl

RefSeq Acc Id:

NM_031665 ⟹ NP_113853

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	69,882,647 - 69,928,895 (+)	NCBI
mRatBN7.2	13	67,332,329 - 67,378,580 (+)	NCBI
Rnor_6.0	13	72,804,218 - 72,850,757 (+)	NCBI
Rnor_5.0	13	77,739,763 - 77,785,254 (+)	NCBI
RGSC_v3.4	13	70,121,864 - 70,169,379 (+)	RGD
Celera	13	67,207,720 - 67,253,510 (+)	RGD

Sequence:

show sequence

CTGCTGTGGGGGCCGGCTTGGAGTGGGATTCGACCCGCGGCGCTGACCGAGTGCTGGACCGACG
GCTGTCGGGCACCCGGGCCTGCGCGCACTGCTGCTCCGGGTCGCCCCGGCCGAGGCGCTGGCCA
CGGTAGACCTCAGGGAGGGCTCGGGCTGCCGGGCCGGGCGCCATGTCCATGGAGGACCCCTTCT
TTGTAGTGAAAGGAGAGGTACAGAAAGCAGTCAACACTGCCCAGGGATTGTTCCAGAGATGGAC
GGAGCTTCTGCAGGGCCCCTCCGCAGCAACGAGGGAAGAGATCGACTGGACCACCAACGAGCTG
AGGAACAATCTCCGCAGCATAGAGTGGGATCTGGAGGACCTGGATGAAACCATCAGCATAGTTG
AAGCAAATCCTAGAAAATTCAACCTGGATGCGACTGAATTGAGCATAAGAAAAGCCTTCATCAC
AAGTACTCGGCAAATTGTCAGGGACATGAAGGATCAGATGTCAGCTTCATCTGTGCAAGCGTTG
GCAGAAAGGAAAAACAGACAGGCGCTACTAGGAGATAGCAGCAGCCAGAATTGGGATGCTGGAG
TGACGGATCGATATGGGCGCCTTGATCGGGAGCTGCAGCTGGCCAACTCCCATTTCATCGAGGA
GCAGCAGGCACAGCAGCAGTTGATTGTGGAACAGCAGGATGAGCAGTTGGAGCTGGTCTCTGGC
AGCATCGGGGTGCTGAAGAACATGTCCCAGCGCATCGGAGGGGAGCTGGAGGAACAGGCAGTCA
TGCTGGATGATTTCTCTCACGAGTTGGAGAGCACTCAGTCTCGACTGGACAACGTGATGAAGAA
ACTTGCAAAAGTGTCTCACATGACCAGTGATCGGCGCCAGTGGTGTGCCATAGCCATCCTCTTC
GCGGTCCTGCTGGTCGTGCTGACCCTCTTCCTAGTGCTGTGATGGTGGTCGCCTTGGCGCTTCT
GCACGAGGACCCAGGGAAGAGGAGCAGCAAGCACTCGGCCACTTACATTCCTCTCCCAGAAACA
CACCTCCGCCCTGCTTCCTCTGTGACTCCGGCATCGGGACAGCCTTCTCTCCCAGCGTTCAAAG
GGCAGGCTTAGAAGAAGGAGGAGGTGACCACATGCCCGGCTGGACAGCAGAAGCCCTTGGCTGC
CCCAGGAAGCTGAGGACAGCAAGCCCCTGCTTTGCCTTACTGGACCTCGCTCCTTGAGGAAGGA
AGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGACTCC
GAGTCATCAGAAGAACTAACAGCCCCACTTACTCCGTTGCTCATTCTGCTGGTCTCTGGCAGTC
TTTCTTTCTACTCAGACCCTTTCCCTGCTTAGATGGGTGCCACTCTCCCTTCAGAAGAGGCCTG
GCAAGAATGCGGGCGTCTAGGGTGTATGTTTCCCATTGCTGTTTGTTTCTTAGCCCGAGAGCTG
GCTGCTGCTGAGGACAGAAGGCTCAGAATCACTTCGTGACAGAAATGCAGTGTTTCGTTTTGCT
GGGTAAGAGCTGAGATTAAATTGCTTTTCCGGGTGTCTTTGTGGCAGGGATAAGCAATAGGAAA
TAGTGAAATCCCTGGGGATTGGGGTGCAGATGACAAAAGGCTTTAAAGGACTGGGGCAGTTGAG
AACAGCAGCACCTGCGTTGGTCTAGCCTATTGGAAGGGCTGGTGATCTCTCTCAAGGCCTGGAC
AGAGCACCAACCTGGTCTGTCCCAGGGCTCTCTCTCCAGAGGTGCAGCTTGCATACGTAGAGCC
CTCATACAGTGTGGAGCAGCATACACCACTCGGCCAGGCGGGCATGGCTTCTTCTCTGATGCGT
ATTCCGATGGCTCTCAGACGAGGTCGAAGGGTCAGCACAGCTACCACATCTGTGCAGAACCCGT
TCTGACACAGAAAGCTGCTTCTGGGCCAGCGGTCCTTACTCCATGAGTAATAGGATGGAGGTAA
GAGAGCTTGTACTCCGTTCTCTAAGGTGACAACTTGACTTCATCATCCATTGGAATCACTGAGG
GAGTCCAAATTCACTGACAGATGCTTCATTGGGTTGAAGTAGCTGAAACTGCTGACACTCCACT
TGGGGCTTTGGGCCTCAGATGTGCAGATGTATGTGGGATTTCTTATACTGTCCCAAATGCATGG
CCTGGTATTGAAGTAGCTGTCAGGTCCAGAGCCAGCCTTTCACACTGGGGCTGCCGCTCAGTCT
TCTGTGCAGGAAGAGCAGCGTCTGGACAGTTTGATCTTTGACCTCTCTTGCTTTGCCTTTCTGT
GCATTCCTTAGCATGCCAACTTTAAAAAGAGCCCTGGGTTGTTCATATGCCTTGGGATTTCGAC
TTTTGGGCCTTTTTTGTTTGTTTATTATTTCCAATGATGTGCTTGCCCAGGTAACTTTTAAATT
GCACTTTTAAATAAATATTTGTAACAATTTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113853	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52709	(Get FASTA)	NCBI Sequence Viewer
	AAH81769	(Get FASTA)	NCBI Sequence Viewer
	EDM09512	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080858.1
	ENSRNOP00000103517
GenBank Protein	Q63635	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113853 ⟸ NM_031665

- UniProtKB:

Q63635 (UniProtKB/Swiss-Prot), A6ICY5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLEDL
DETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQMSASSVQALAERKNRQALLGDSS
SQNWDAGVTDRYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLKNMSQRIGG
ELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQWCAIAILFAVLLVVLTLFLVL

hide sequence

Ensembl Acc Id:

ENSRNOP00000037536 ⟸ ENSRNOT00000035145

Ensembl Acc Id:

ENSRNOP00000080858 ⟸ ENSRNOT00000099649

Ensembl Acc Id:

ENSRNOP00000103517 ⟸ ENSRNOT00000128442

Ensembl Acc Id:

ENSRNOP00000109135 ⟸ ENSRNOT00000157101

Protein Domains

t-SNARE coiled-coil homology

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63635-F1-model_v2	AlphaFold	Q63635	1-255	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698905

Promoter ID:

EPDNEW_R9430

Type:

initiation region

Name:

Stx6_1

Description:

syntaxin 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	72,804,245 - 72,804,305	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61915	AgrOrtholog
BioCyc Gene	G2FUF-17848	BioCyc
Ensembl Genes	ENSRNOG00000003402	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000099649.1	UniProtKB/Swiss-Prot
	ENSRNOT00000128442	ENTREZGENE
Gene3D-CATH	1.20.5.110	UniProtKB/Swiss-Prot
	1.20.58.90	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134641	IMAGE-MGC_LOAD
InterPro	SNARE	UniProtKB/Swiss-Prot
	Syntaxin-6_N	UniProtKB/Swiss-Prot
	Syntaxin/epimorphin_CS	UniProtKB/Swiss-Prot
	T_SNARE_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:60562	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93348	IMAGE-MGC_LOAD
NCBI Gene	60562	ENTREZGENE
PANTHER	GOLGI SNARE BET1-RELATED	UniProtKB/Swiss-Prot
Pfam	SNARE	UniProtKB/Swiss-Prot
	Syntaxin-6_N	UniProtKB/Swiss-Prot
PhenoGen	Stx6	PhenoGen
PROSITE	SYNTAXIN	UniProtKB/Swiss-Prot
	T_SNARE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003402	RatGTEx
SMART	t_SNARE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SNARE fusion complex	UniProtKB/Swiss-Prot
	SSF47661	UniProtKB/Swiss-Prot
UniProt	A0A8L2QLH0_RAT	UniProtKB/TrEMBL
	A0ABK0LSM3_RAT	UniProtKB/TrEMBL
	A6ICY5	ENTREZGENE, UniProtKB/TrEMBL
	Q63635	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Stx6	syntaxin 6			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the Golgi apparatus	61759
gene_function	vesicular transport receptor	61759
gene_protein	255 amino acids	61759

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD