Symbol:
Nr4a3
Name:
nuclear receptor subfamily 4, group A, member 3
RGD ID:
61882
Description:
Enables several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; nuclear glucocorticoid receptor binding activity; and protein homodimerization activity. Involved in several processes, including animal organ regeneration; positive regulation of cardiac muscle hypertrophy; and regulation of type B pancreatic cell proliferation. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in extraskeletal myxoid chondrosarcoma. Orthologous to human NR4A3 (nuclear receptor subfamily 4 group A member 3); INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neuron-derived orphan receptor; neuron-derived orphan receptor 1; neuron-derived orphan receptor 1/2; NOR-2; nuclear hormone receptor NOR-1/NOR-2; nuclear receptor subfamily 4 group A member 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Nr4a3 (nuclear receptor subfamily 4, group A, member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nr4a3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nr4a3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nr4a3 (nuclear receptor subfamily 4 group A member 3)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR52B4 (olfactory receptor family 52 subfamily B member 4)
HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Nr4a3 (nuclear receptor subfamily 4, group A, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NR4A3 (nuclear receptor subfamily 4 group A member 3)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nr4a3 (nuclear receptor subfamily 4, group A, member 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nhr-6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Hr38
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nr4a2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 67,157,141 - 67,198,287 (+) NCBI GRCr8 mRatBN7.2 5 62,361,588 - 62,401,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 62,361,822 - 62,402,733 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 64,336,680 - 64,376,440 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 66,155,972 - 66,195,731 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 66,125,439 - 66,165,198 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 63,781,801 - 63,822,890 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 63,781,801 - 63,821,637 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 68,298,772 - 68,339,861 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 64,713,468 - 64,753,311 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 64,718,506 - 64,758,343 (+) NCBI Celera 5 65,193,786 - 65,233,628 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nr4a3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NR4A3 mRNA CTD PMID:22079256 Nr4a3 Rat 1,2,4-trimethylbenzene increases expression EXP 6480464 pseudocumene results in increased expression of NR4A3 protein CTD PMID:17337753 Nr4a3 Rat 1,8-cineole decreases expression ISO NR4A3 (Homo sapiens) 6480464 Eucalyptol results in decreased expression of NR4A3 mRNA CTD PMID:36331666 Nr4a3 Rat 15-acetyldeoxynivalenol increases expression ISO NR4A3 (Homo sapiens) 6480464 15-acetyldeoxynivalenol results in increased expression of NR4A3 mRNA CTD PMID:23792671 Nr4a3 Rat 17beta-estradiol increases expression ISO NR4A3 (Homo sapiens) 6480464 Estradiol results in increased expression of NR4A3 mRNA CTD PMID:31614463 Nr4a3 Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO NR4A3 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Nr4a3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nr4a3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NR4A3 mRNA CTD PMID:19933214 and PMID:24058054 Nr4a3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NR4A3 mRNA CTD PMID:33387578 Nr4a3 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Nr4a3 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Nr4a3 Rat 2-trans,6-trans,10-trans-geranylgeranyl diphosphate multiple interactions ISO NR4A3 (Homo sapiens) 6480464 geranylgeranyl pyrophosphate inhibits the reaction [Simvastatin results in decreased expression of NR4A3 mRNA] CTD PMID:16005304 Nr4a3 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Nr4a3 (Mus musculus) 6480464 3 more ... CTD PMID:30312631 Nr4a3 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Nr4a3 (Mus musculus) 6480464 3 more ... CTD PMID:30312631 Nr4a3 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Nr4a3 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NR4A3 mRNA CTD PMID:18648102 Nr4a3 Rat 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of NR4A3 mRNA CTD PMID:26186136 Nr4a3 Rat 4-hydroxyphenyl retinamide increases expression ISO Nr4a3 (Mus musculus) 6480464 Fenretinide results in increased expression of NR4A3 mRNA CTD PMID:28973697 Nr4a3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NR4A3 mRNA CTD PMID:24780913 Nr4a3 Rat 6-propyl-2-thiouracil multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of NR4A3 mRNA CTD PMID:36706583 Nr4a3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NR4A3 mRNA CTD PMID:25825206 and PMID:30047161 Nr4a3 Rat 6alpha-methylprednisolone decreases expression ISO NR4A3 (Homo sapiens) 6480464 Methylprednisolone results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat 8-Br-cAMP increases expression ISO NR4A3 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of NR4A3 mRNA CTD PMID:22079614 Nr4a3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of NR4A3 mRNA CTD PMID:31881176 Nr4a3 Rat acetylsalicylic acid increases expression ISO NR4A3 (Homo sapiens) 6480464 Aspirin results in increased expression of NR4A3 mRNA CTD PMID:15928584 Nr4a3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of NR4A3 mRNA CTD PMID:22197712 Nr4a3 Rat all-trans-retinoic acid multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of NR4A3 mRNA CTD PMID:16443354 Nr4a3 Rat all-trans-retinoic acid multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NR4A3 mRNA CTD PMID:36189433 Nr4a3 Rat all-trans-retinoic acid increases expression ISO NR4A3 (Homo sapiens) 6480464 Tretinoin results in increased expression of NR4A3 mRNA CTD PMID:23724009 and PMID:33167477 Nr4a3 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of NR4A3 mRNA CTD PMID:30047161 Nr4a3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NR4A3 mRNA CTD PMID:16483693 Nr4a3 Rat aristolochic acid A increases expression ISO NR4A3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NR4A3 mRNA CTD PMID:33212167 Nr4a3 Rat arsane decreases expression ISO Nr4a3 (Mus musculus) 6480464 Arsenic results in decreased expression of NR4A3 mRNA CTD PMID:19654921 Nr4a3 Rat arsenic atom decreases expression ISO Nr4a3 (Mus musculus) 6480464 Arsenic results in decreased expression of NR4A3 mRNA CTD PMID:19654921 Nr4a3 Rat arsenite(3-) affects expression ISO NR4A3 (Homo sapiens) 6480464 arsenite affects the expression of NR4A3 mRNA CTD PMID:22959463 Nr4a3 Rat arsenite(3-) increases methylation ISO NR4A3 (Homo sapiens) 6480464 arsenite results in increased methylation of NR4A3 promoter CTD PMID:23974009 Nr4a3 Rat arsenous acid increases expression ISO Nr4a3 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of NR4A3 mRNA CTD PMID:35676786 Nr4a3 Rat astemizole increases expression EXP 6480464 Astemizole results in increased expression of NR4A3 mRNA CTD PMID:20221588 Nr4a3 Rat atrazine increases expression ISO NR4A3 (Homo sapiens) 6480464 Atrazine results in increased expression of NR4A3 mRNA CTD PMID:18461179 Nr4a3 Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of NR4A3 mRNA CTD PMID:36841081 Nr4a3 Rat azathioprine decreases expression ISO NR4A3 (Homo sapiens) 6480464 Azathioprine results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat bathocuproine disulfonic acid multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of NR4A3 mRNA] CTD PMID:15477007 Nr4a3 Rat benzene increases expression ISO NR4A3 (Homo sapiens) 6480464 Benzene results in increased expression of NR4A3 mRNA CTD PMID:19162166 Nr4a3 Rat benzene-1,2,4-triol decreases expression ISO NR4A3 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of NR4A3 mRNA CTD PMID:39245080 Nr4a3 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NR4A3 mRNA CTD PMID:21839799 Nr4a3 Rat benzo[a]pyrene decreases expression ISO NR4A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NR4A3 mRNA CTD PMID:38036013 Nr4a3 Rat benzo[a]pyrene increases expression ISO NR4A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of NR4A3 mRNA CTD PMID:32234424 Nr4a3 Rat benzo[a]pyrene decreases methylation ISO NR4A3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NR4A3 5' UTR CTD PMID:27901495 Nr4a3 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of NR4A3 mRNA CTD PMID:19560483 Nr4a3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NR4A3 promoter CTD PMID:23359474 Nr4a3 Rat bisphenol A increases expression ISO Nr4a3 (Mus musculus) 6480464 bisphenol A results in increased expression of NR4A3 mRNA CTD PMID:14967926 and PMID:32156529 Nr4a3 Rat bisphenol A affects methylation ISO Nr4a3 (Mus musculus) 6480464 bisphenol A affects the methylation of NR4A3 promoter CTD PMID:27334623 Nr4a3 Rat bisphenol A decreases expression ISO NR4A3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NR4A3 mRNA CTD PMID:27685785 Nr4a3 Rat bisphenol A decreases expression ISO Nr4a3 (Mus musculus) 6480464 bisphenol A results in decreased expression of NR4A3 mRNA CTD PMID:25594700 and PMID:37611474 Nr4a3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NR4A3 mRNA CTD PMID:25181051 Nr4a3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NR4A3 mRNA CTD PMID:26141625 Nr4a3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NR4A3 promoter CTD PMID:23359474 Nr4a3 Rat bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of NR4A3 mRNA CTD PMID:27567155 Nr4a3 Rat bisphenol AF decreases expression ISO Nr4a3 (Mus musculus) 6480464 bisphenol AF results in decreased expression of NR4A3 mRNA CTD PMID:37611474 Nr4a3 Rat bisphenol F increases expression ISO NR4A3 (Homo sapiens) 6480464 bisphenol F results in increased expression of NR4A3 mRNA CTD PMID:33476716 Nr4a3 Rat bisphenol F decreases expression ISO Nr4a3 (Mus musculus) 6480464 bisphenol F results in decreased expression of NR4A3 mRNA CTD PMID:37611474 Nr4a3 Rat bisphenol F increases expression ISO Nr4a3 (Mus musculus) 6480464 bisphenol F results in increased expression of NR4A3 mRNA CTD PMID:30951980 Nr4a3 Rat buta-1,3-diene decreases expression ISO Nr4a3 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of NR4A3 mRNA CTD PMID:29038090 Nr4a3 Rat butanal increases expression ISO NR4A3 (Homo sapiens) 6480464 butyraldehyde results in increased expression of NR4A3 mRNA CTD PMID:26079696 Nr4a3 Rat Butylbenzyl phthalate decreases expression EXP 6480464 butylbenzyl phthalate results in decreased expression of NR4A3 mRNA CTD PMID:19560483 Nr4a3 Rat Butylbenzyl phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat C.I. Natural Red 20 multiple interactions ISO Nr4a3 (Mus musculus) 6480464 shikonin inhibits the reaction [Antigen-Antibody Complex results in increased expression of NR4A3 mRNA] and shikonin inhibits the reaction [Calcimycin results in increased expression of NR4A3 mRNA] CTD PMID:25451590 Nr4a3 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of NR4A3 mRNA CTD PMID:19167457 Nr4a3 Rat cadmium acetate increases expression EXP 6480464 cadmium acetate results in increased expression of NR4A3 mRNA CTD PMID:15016657 Nr4a3 Rat cadmium acetate increases expression ISO NR4A3 (Homo sapiens) 6480464 cadmium acetate results in increased expression of NR4A3 mRNA CTD PMID:12965115 and PMID:15016657 Nr4a3 Rat Calcimycin increases expression ISO Nr4a3 (Mus musculus) 6480464 Calcimycin results in increased expression of NR4A3 mRNA CTD PMID:25451590 Nr4a3 Rat Calcimycin multiple interactions ISO Nr4a3 (Mus musculus) 6480464 shikonin inhibits the reaction [Calcimycin results in increased expression of NR4A3 mRNA] CTD PMID:25451590 Nr4a3 Rat cannabidiol multiple interactions ISO Nr4a3 (Mus musculus) 6480464 Cannabidiol inhibits the reaction [MOG protein modified form results in increased expression of NR4A3 mRNA] CTD PMID:27256343 Nr4a3 Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of NR4A3 mRNA CTD PMID:19395590 Nr4a3 Rat CGP 52608 multiple interactions ISO NR4A3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NR4A3 gene] CTD PMID:28238834 Nr4a3 Rat chlordecone increases expression ISO Nr4a3 (Mus musculus) 6480464 Chlordecone results in increased expression of NR4A3 mRNA CTD PMID:33711761 Nr4a3 Rat cisplatin multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of NR4A3 mRNA CTD PMID:27392435 Nr4a3 Rat cisplatin decreases expression ISO NR4A3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of NR4A3 mRNA CTD PMID:27392435 Nr4a3 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of NR4A3 mRNA CTD PMID:27899881 Nr4a3 Rat colforsin daropate hydrochloride multiple interactions ISO NR4A3 (Homo sapiens) 6480464 NR4A3 protein inhibits the reaction [Colforsin results in increased expression of CYP19A1 mRNA] CTD PMID:19822197 Nr4a3 Rat copper(II) sulfate increases expression ISO NR4A3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NR4A3 mRNA CTD PMID:19549813 Nr4a3 Rat crocidolite asbestos increases expression ISO NR4A3 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of NR4A3 mRNA CTD PMID:18687144 Nr4a3 Rat crocidolite asbestos affects expression ISO NR4A3 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of NR4A3 mRNA CTD PMID:25757056 Nr4a3 Rat CU-O LINKAGE increases expression ISO NR4A3 (Homo sapiens) 6480464 cupric oxide results in increased expression of NR4A3 mRNA and cupric oxide results in increased expression of NR4A3 protein CTD PMID:22077320 Nr4a3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NR4A3 mRNA CTD PMID:26577399 Nr4a3 Rat cyclosporin A multiple interactions ISO Nr4a3 (Mus musculus) 6480464 Cyclosporine inhibits the reaction [Antigen-Antibody Complex results in increased expression of NR4A3 mRNA] CTD PMID:25451590 Nr4a3 Rat cylindrospermopsin increases expression ISO NR4A3 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of NR4A3 mRNA CTD PMID:24921660 Nr4a3 Rat DDE decreases expression ISO NR4A3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of NR4A3 mRNA CTD PMID:38568856 Nr4a3 Rat deoxynivalenol increases expression ISO NR4A3 (Homo sapiens) 6480464 deoxynivalenol results in increased expression of NR4A3 mRNA CTD PMID:26763390 Nr4a3 Rat dexamethasone increases expression ISO NR4A3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of NR4A3 mRNA CTD PMID:25047013 Nr4a3 Rat diarsenic trioxide increases expression ISO Nr4a3 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of NR4A3 mRNA CTD PMID:35676786 Nr4a3 Rat Dibutyl phosphate affects expression ISO NR4A3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NR4A3 mRNA CTD PMID:37042841 Nr4a3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of NR4A3 mRNA CTD PMID:19560483 Nr4a3 Rat dibutyl phthalate decreases expression ISO Nr4a3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NR4A3 mRNA and Dibutyl Phthalate results in decreased expression of NR4A3 protein CTD PMID:31841868 Nr4a3 Rat dibutyl phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NR4A3 mRNA CTD PMID:21266533 and PMID:21745491 Nr4a3 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of NR4A3 promoter CTD PMID:23359474 Nr4a3 Rat dibutyl phthalate increases expression ISO Nr4a3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NR4A3 mRNA CTD PMID:17361019 and PMID:21266533 Nr4a3 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of NR4A3 mRNA CTD PMID:18636392 Nr4a3 Rat dieldrin increases expression ISO NR4A3 (Homo sapiens) 6480464 Dieldrin results in increased expression of NR4A3 mRNA CTD PMID:31068361 Nr4a3 Rat diethyl phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat diiodine multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of NR4A3 mRNA CTD PMID:36706583 Nr4a3 Rat diisobutyl phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat diisononyl phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NR4A3 mRNA CTD PMID:39150890 Nr4a3 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of NR4A3 mRNA CTD PMID:33729688 Nr4a3 Rat dipentyl phthalate decreases expression EXP 6480464 di-n-pentyl phthalate results in decreased expression of NR4A3 mRNA CTD PMID:19560483 Nr4a3 Rat dorsomorphin multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NR4A3 mRNA CTD PMID:27188386 Nr4a3 Rat doxorubicin decreases expression ISO NR4A3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NR4A3 mRNA CTD PMID:29803840 Nr4a3 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of NR4A3 mRNA CTD PMID:32289291 Nr4a3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of NR4A3 mRNA CTD PMID:29391264 Nr4a3 Rat epoxiconazole increases expression ISO Nr4a3 (Mus musculus) 6480464 epoxiconazole results in increased expression of NR4A3 mRNA CTD PMID:35436446 Nr4a3 Rat ethanol affects expression ISO Nr4a3 (Mus musculus) 6480464 Ethanol affects the expression of NR4A3 mRNA CTD PMID:30319688 Nr4a3 Rat ethanol increases expression ISO NR4A3 (Homo sapiens) 6480464 Ethanol results in increased expression of NR4A3 mRNA CTD PMID:37149095 Nr4a3 Rat fenoterol increases expression ISO Nr4a3 (Mus musculus) 6480464 Fenoterol results in increased expression of NR4A3 mRNA CTD PMID:34601065 Nr4a3 Rat fluoranthene multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of NR4A3 mRNA CTD PMID:28329830 Nr4a3 Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of NR4A3 mRNA CTD PMID:17033635 Nr4a3 Rat folic acid decreases expression ISO Nr4a3 (Mus musculus) 6480464 Folic Acid results in decreased expression of NR4A3 mRNA CTD PMID:25006883 Nr4a3 Rat FR900359 affects phosphorylation ISO NR4A3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of NR4A3 protein CTD PMID:37730182 Nr4a3 Rat gemcitabine increases expression ISO NR4A3 (Homo sapiens) 6480464 Gemcitabine results in increased expression of NR4A3 mRNA CTD PMID:17039268 Nr4a3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NR4A3 mRNA CTD PMID:22061828 Nr4a3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NR4A3 mRNA CTD PMID:33387578 Nr4a3 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of NR4A3 mRNA CTD PMID:24915197 Nr4a3 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of NR4A3 mRNA CTD PMID:38314887 Nr4a3 Rat graphite affects expression EXP 6480464 Graphite affects the expression of NR4A3 mRNA CTD PMID:29933104 Nr4a3 Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of NR4A3 mRNA CTD PMID:19695244 Nr4a3 Rat hydrogen cyanide increases expression ISO Nr4a3 (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of NR4A3 mRNA CTD PMID:33914522 Nr4a3 Rat ionomycin multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of NR4A3 mRNA] and [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of NR4A3 mRNA CTD PMID:15477007 Nr4a3 Rat isoprenaline increases expression ISO Nr4a3 (Mus musculus) 6480464 Isoproterenol results in increased expression of NR4A3 mRNA CTD PMID:34601065 Nr4a3 Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of NR4A3 mRNA CTD PMID:19700661 Nr4a3 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NR4A3 mRNA CTD PMID:20080153 Nr4a3 Rat L-ascorbic acid multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [Tretinoin co-treated with Ascorbic Acid] results in increased expression of NR4A3 mRNA CTD PMID:16443354 Nr4a3 Rat leflunomide increases expression ISO NR4A3 (Homo sapiens) 6480464 leflunomide results in increased expression of NR4A3 mRNA CTD PMID:28988120 Nr4a3 Rat lipopolysaccharide multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Nr4a3 Rat lipopolysaccharide increases expression ISO NR4A3 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of NR4A3 mRNA CTD PMID:35811015 Nr4a3 Rat LY294002 multiple interactions ISO NR4A3 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of NR4A3 mRNA] CTD PMID:12710931 Nr4a3 Rat mabuterol increases expression ISO Nr4a3 (Mus musculus) 6480464 mabuterol results in increased expression of NR4A3 mRNA CTD PMID:34601065 Nr4a3 Rat malathion increases expression ISO NR4A3 (Homo sapiens) 6480464 Malathion results in increased expression of NR4A3 mRNA CTD PMID:37047231 Nr4a3 Rat malathion decreases methylation ISO NR4A3 (Homo sapiens) 6480464 Malathion results in decreased methylation of NR4A3 promoter CTD PMID:37047231 Nr4a3 Rat melphalan increases expression ISO NR4A3 (Homo sapiens) 6480464 Melphalan results in increased expression of NR4A3 mRNA CTD PMID:22363485 Nr4a3 Rat metformin decreases expression EXP 6480464 Metformin results in decreased expression of NR4A3 mRNA CTD PMID:31324951 Nr4a3 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of NR4A3 mRNA CTD PMID:19564919 Nr4a3 Rat methamphetamine multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in increased expression of NR4A3 mRNA CTD PMID:19564919 Nr4a3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of NR4A3 mRNA CTD PMID:30047161 Nr4a3 Rat methotrexate decreases expression ISO NR4A3 (Homo sapiens) 6480464 Methotrexate results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of NR4A3 gene CTD PMID:23303685 Nr4a3 Rat methylisothiazolinone increases expression ISO NR4A3 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of NR4A3 mRNA CTD PMID:31629900 Nr4a3 Rat mevalonic acid multiple interactions ISO NR4A3 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in decreased expression of NR4A3 mRNA] CTD PMID:16005304 Nr4a3 Rat milrinone increases expression EXP 6480464 Milrinone results in increased expression of NR4A3 mRNA CTD PMID:22936366 Nr4a3 Rat mono(2-ethylhexyl) phthalate increases expression ISO NR4A3 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of NR4A3 mRNA CTD PMID:19822197 Nr4a3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of NR4A3 mRNA CTD PMID:36189433 Nr4a3 Rat mono(2-ethylhexyl) phthalate increases expression ISO Nr4a3 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of NR4A3 mRNA CTD PMID:36189433 Nr4a3 Rat N-methyl-4-phenylpyridinium multiple interactions ISO NR4A3 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of NR4A3 mRNA] CTD PMID:12710931 Nr4a3 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NR4A3 mRNA CTD PMID:28801915 Nr4a3 Rat naphthalenes increases expression EXP 6480464 Naphthalenes results in increased expression of NR4A3 protein CTD PMID:17337753 Nr4a3 Rat nickel atom increases expression ISO NR4A3 (Homo sapiens) 6480464 Nickel results in increased expression of NR4A3 mRNA CTD PMID:23195993 and PMID:25583101 Nr4a3 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of NR4A3 mRNA CTD PMID:18636392 Nr4a3 Rat ozone multiple interactions ISO Nr4a3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of NR4A3 mRNA CTD PMID:34911549 Nr4a3 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of NR4A3 mRNA CTD PMID:16716893 Nr4a3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NR4A3 mRNA CTD PMID:33387578 Nr4a3 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of NR4A3 mRNA CTD PMID:32680482 Nr4a3 Rat paraquat increases expression ISO NR4A3 (Homo sapiens) 6480464 Paraquat results in increased expression of NR4A3 mRNA CTD PMID:34097952 Nr4a3 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Nr4a3 Rat perfluorohexanesulfonic acid increases expression ISO Nr4a3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of NR4A3 mRNA CTD PMID:37995155 Nr4a3 Rat perfluorooctanoic acid decreases expression ISO Nr4a3 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of NR4A3 mRNA CTD PMID:30711707 Nr4a3 Rat permethrin increases expression EXP 6480464 Permethrin results in increased expression of NR4A3 mRNA CTD PMID:19017407 Nr4a3 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of NR4A3 mRNA CTD PMID:31324951 Nr4a3 Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of NR4A3 mRNA CTD PMID:18158353 Nr4a3 Rat phorbol 13-acetate 12-myristate multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of NR4A3 mRNA] more ... CTD PMID:15477007 and PMID:16979875 Nr4a3 Rat pioglitazone increases expression ISO Nr4a3 (Mus musculus) 6480464 pioglitazone results in increased expression of NR4A3 mRNA CTD PMID:17785466 Nr4a3 Rat pirinixic acid increases expression ISO Nr4a3 (Mus musculus) 6480464 pirinixic acid results in increased expression of NR4A3 mRNA CTD PMID:16985257 Nr4a3 Rat piroxicam decreases expression ISO NR4A3 (Homo sapiens) 6480464 Piroxicam results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat potassium chromate multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NR4A3 mRNA CTD PMID:22079256 Nr4a3 Rat potassium chromate increases expression ISO NR4A3 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of NR4A3 mRNA CTD PMID:22079256 Nr4a3 Rat potassium cyanide increases expression ISO Nr4a3 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of NR4A3 mRNA CTD PMID:33914522 Nr4a3 Rat potassium dichromate increases expression ISO Nr4a3 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of NR4A3 mRNA CTD PMID:23608068 Nr4a3 Rat prednisolone decreases expression ISO NR4A3 (Homo sapiens) 6480464 Prednisolone results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of NR4A3 mRNA CTD PMID:19162173 Nr4a3 Rat propan-2-ol increases expression ISO NR4A3 (Homo sapiens) 6480464 2-Propanol results in increased expression of NR4A3 mRNA CTD PMID:37149095 Nr4a3 Rat pyrrolidine dithiocarbamate multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of NR4A3 mRNA] CTD PMID:15477007 Nr4a3 Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of NR4A3 mRNA CTD PMID:18178720 Nr4a3 Rat raloxifene multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in increased expression of NR4A3 mRNA CTD PMID:19059307 Nr4a3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Nr4a3 Rat Salmeterol xinafoate increases expression ISO Nr4a3 (Mus musculus) 6480464 Salmeterol Xinafoate results in increased expression of NR4A3 mRNA CTD PMID:34601065 Nr4a3 Rat SB 431542 multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NR4A3 mRNA CTD PMID:27188386 Nr4a3 Rat SCH 23390 multiple interactions EXP 6480464 [Methamphetamine co-treated with SCH 23390] results in increased expression of NR4A3 mRNA CTD PMID:19564919 Nr4a3 Rat Shikonin multiple interactions ISO Nr4a3 (Mus musculus) 6480464 shikonin inhibits the reaction [Antigen-Antibody Complex results in increased expression of NR4A3 mRNA] and shikonin inhibits the reaction [Calcimycin results in increased expression of NR4A3 mRNA] CTD PMID:25451590 Nr4a3 Rat silicon dioxide decreases expression ISO NR4A3 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of NR4A3 mRNA CTD PMID:25895662 Nr4a3 Rat silicon dioxide increases expression ISO Nr4a3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NR4A3 mRNA CTD PMID:23221170 Nr4a3 Rat silicon dioxide increases expression ISO NR4A3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NR4A3 mRNA and Silicon Dioxide results in increased expression of NR4A3 mRNA CTD PMID:22300531 more ... Nr4a3 Rat simvastatin multiple interactions ISO NR4A3 (Homo sapiens) 6480464 geranylgeranyl pyrophosphate inhibits the reaction [Simvastatin results in decreased expression of NR4A3 mRNA] and Mevalonic Acid inhibits the reaction [Simvastatin results in decreased expression of NR4A3 mRNA] CTD PMID:16005304 Nr4a3 Rat sodium arsenite increases expression ISO NR4A3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of NR4A3 mRNA alternative form CTD PMID:21281968 Nr4a3 Rat sodium arsenite increases expression ISO Nr4a3 (Mus musculus) 6480464 sodium arsenite results in increased expression of NR4A3 mRNA CTD PMID:37682722 Nr4a3 Rat sodium arsenite decreases expression ISO NR4A3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NR4A3 mRNA CTD PMID:34032870 Nr4a3 Rat sodium aurothiomalate decreases expression ISO NR4A3 (Homo sapiens) 6480464 Gold Sodium Thiomalate results in decreased expression of NR4A3 mRNA CTD PMID:19192274 Nr4a3 Rat sodium hypochlorite increases expression ISO NR4A3 (Homo sapiens) 6480464 Sodium Hypochlorite results in increased expression of NR4A3 mRNA CTD PMID:37149095 Nr4a3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of NR4A3 mRNA CTD PMID:19281266 Nr4a3 Rat styrene decreases expression ISO Nr4a3 (Mus musculus) 6480464 Styrene results in decreased expression of NR4A3 mRNA CTD PMID:28951217 Nr4a3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of NR4A3 mRNA CTD PMID:30047161 Nr4a3 Rat sulforaphane decreases expression ISO NR4A3 (Homo sapiens) 6480464 sulforaphane results in decreased expression of NR4A3 mRNA CTD PMID:31838189 Nr4a3 Rat tamoxifen multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR2 protein] results in increased expression of NR4A3 mRNA CTD PMID:19059307 Nr4a3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NR4A3 mRNA CTD PMID:34492290 Nr4a3 Rat thiram increases expression ISO NR4A3 (Homo sapiens) 6480464 Thiram results in increased expression of NR4A3 mRNA CTD PMID:38568856 Nr4a3 Rat titanium dioxide affects expression EXP 6480464 titanium dioxide affects the expression of NR4A3 mRNA CTD PMID:30012374 Nr4a3 Rat titanium dioxide decreases methylation ISO Nr4a3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NR4A3 gene and titanium dioxide results in decreased methylation of NR4A3 promoter CTD PMID:35295148 Nr4a3 Rat titanium dioxide affects expression ISO Nr4a3 (Mus musculus) 6480464 titanium dioxide affects the expression of NR4A3 mRNA CTD PMID:35295148 Nr4a3 Rat titanium dioxide increases methylation ISO Nr4a3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of NR4A3 promoter CTD PMID:35295148 Nr4a3 Rat torcetrapib increases expression ISO NR4A3 (Homo sapiens) 6480464 torcetrapib results in increased expression of NR4A3 mRNA CTD PMID:19164467 and PMID:23228038 Nr4a3 Rat Tributyltin oxide increases expression EXP 6480464 bis(tri-n-butyltin)oxide results in increased expression of NR4A3 mRNA CTD PMID:17553608 Nr4a3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NR4A3 mRNA CTD PMID:33387578 Nr4a3 Rat triphenylstannane decreases expression EXP 6480464 triphenyltin results in decreased expression of NR4A3 mRNA CTD PMID:32504733 Nr4a3 Rat triptonide increases expression ISO Nr4a3 (Mus musculus) 6480464 triptonide results in increased expression of NR4A3 mRNA CTD PMID:33045310 Nr4a3 Rat troglitazone increases expression ISO Nr4a3 (Mus musculus) 6480464 troglitazone results in increased expression of NR4A3 mRNA CTD PMID:17785466 Nr4a3 Rat troglitazone decreases expression ISO Nr4a3 (Mus musculus) 6480464 troglitazone results in decreased expression of NR4A3 mRNA CTD PMID:28973697 Nr4a3 Rat undecane increases expression EXP 6480464 undecane results in increased expression of NR4A3 protein CTD PMID:17337753 Nr4a3 Rat urethane increases expression ISO NR4A3 (Homo sapiens) 6480464 Urethane results in increased expression of NR4A3 mRNA CTD PMID:28818685 Nr4a3 Rat valproic acid affects expression ISO NR4A3 (Homo sapiens) 6480464 Valproic Acid affects the expression of NR4A3 mRNA CTD PMID:25979313 Nr4a3 Rat valproic acid decreases expression ISO NR4A3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NR4A3 mRNA CTD PMID:28001369 Nr4a3 Rat valproic acid multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NR4A3 mRNA CTD PMID:27188386 Nr4a3 Rat valproic acid increases expression ISO NR4A3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NR4A3 mRNA CTD PMID:23179753 more ... Nr4a3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NR4A3 mRNA CTD PMID:19015723 Nr4a3 Rat Y-27632 decreases expression ISO NR4A3 (Homo sapiens) 6480464 Y 27632 results in decreased expression of NR4A3 mRNA CTD PMID:16005304 Nr4a3 Rat zinc atom multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NR4A3 mRNA and [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of NR4A3 mRNA CTD PMID:16979875 and PMID:18593933 Nr4a3 Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of NR4A3 mRNA CTD PMID:19111725 Nr4a3 Rat zinc(0) multiple interactions ISO NR4A3 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of NR4A3 mRNA and [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of NR4A3 mRNA CTD PMID:16979875 and PMID:18593933 Nr4a3 Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of NR4A3 mRNA CTD PMID:19111725
(-)-epigallocatechin 3-gallate (ISO) 1,2,4-trimethylbenzene (EXP) 1,8-cineole (ISO) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-trans,6-trans,10-trans-geranylgeranyl diphosphate (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP,ISO) 6alpha-methylprednisolone (ISO) 8-Br-cAMP (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) astemizole (EXP) atrazine (EXP,ISO) azathioprine (ISO) bathocuproine disulfonic acid (ISO) benzene (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) butanal (ISO) Butylbenzyl phthalate (EXP,ISO) C.I. Natural Red 20 (ISO) C60 fullerene (EXP) cadmium acetate (EXP,ISO) Calcimycin (ISO) cannabidiol (ISO) carbonyl sulfide (EXP) CGP 52608 (ISO) chlordecone (ISO) cisplatin (ISO) cocaine (EXP) colforsin daropate hydrochloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) DDE (ISO) deoxynivalenol (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) dieldrin (ISO) diethyl phthalate (ISO) diiodine (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP) dipentyl phthalate (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fenoterol (ISO) fluoranthene (ISO) fluoxetine (EXP) folic acid (ISO) FR900359 (ISO) gemcitabine (ISO) gentamycin (EXP) glycidol (EXP) glyphosate (EXP) graphite (EXP) haloperidol (EXP) hydrogen cyanide (ISO) ionomycin (ISO) isoprenaline (ISO) kainic acid (EXP) ketamine (EXP) L-ascorbic acid (ISO) leflunomide (ISO) lipopolysaccharide (ISO) LY294002 (ISO) mabuterol (ISO) malathion (ISO) melphalan (ISO) metformin (EXP) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) methylisothiazolinone (ISO) mevalonic acid (ISO) milrinone (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) naphthalenes (EXP) nickel atom (ISO) ozone (EXP,ISO) paracetamol (EXP) paraquat (EXP,ISO) PCB138 (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenformin (EXP) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium chromate (ISO) potassium cyanide (ISO) potassium dichromate (ISO) prednisolone (ISO) pregnenolone 16alpha-carbonitrile (EXP) propan-2-ol (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (EXP) raloxifene (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Salmeterol xinafoate (ISO) SB 431542 (ISO) SCH 23390 (EXP) Shikonin (ISO) silicon dioxide (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium aurothiomalate (ISO) sodium hypochlorite (ISO) Soman (EXP) styrene (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) tamoxifen (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (EXP,ISO) torcetrapib (ISO) Tributyltin oxide (EXP) trichloroethene (EXP) triphenylstannane (EXP) triptonide (ISO) troglitazone (ISO) undecane (EXP) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) Y-27632 (ISO) zinc atom (EXP,ISO) zinc(0) (EXP,ISO)
Biological Process
adult behavior (ISO) animal organ regeneration (IEP) axon guidance (ISO) cellular respiration (ISO,ISS) cellular response to catecholamine stimulus (ISO,ISS) cellular response to corticotropin-releasing hormone stimulus (IBA,ISO,ISS) cellular response to leptin stimulus (ISO,ISS) common myeloid progenitor cell proliferation (ISO,ISS) dendritic cell apoptotic process (ISO) energy homeostasis (ISO,ISS) fat cell differentiation (ISO,ISS) gastrulation (ISO,ISS) hippocampus development (ISO) inner ear morphogenesis (ISO) intracellular receptor signaling pathway (IEA) intracellular signal transduction (ISO,ISS) mast cell degranulation (ISO,ISS) mesoderm formation (ISO) negative regulation of neuron apoptotic process (ISO) negative regulation of smooth muscle cell apoptotic process (ISO) negative regulation of transcription by RNA polymerase II (ISO,ISS) neuromuscular process controlling balance (ISO) neuron apoptotic process (ISO) platelet-derived growth factor receptor signaling pathway (ISO) positive regulation of cardiac muscle hypertrophy (IMP) positive regulation of cell cycle (ISO) positive regulation of D-glucose transmembrane transport (ISO,ISS) positive regulation of dendritic cell apoptotic process (ISO) positive regulation of DNA-templated transcription (ISO) positive regulation of epithelial cell proliferation (ISO,ISS) positive regulation of feeding behavior (ISO,ISS) positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway (ISO,ISS) positive regulation of mast cell cytokine production (ISO,ISS) positive regulation of monocyte aggregation (ISO,ISS) positive regulation of smooth muscle cell proliferation (ISO,ISS) positive regulation of transcription by RNA polymerase II (IDA,ISO) positive regulation of vascular associated smooth muscle cell migration (ISO) positive regulation of vascular associated smooth muscle cell proliferation (ISO) regulation of DNA-templated transcription (IEA) regulation of smooth muscle cell proliferation (ISO,ISS) regulation of transcription by RNA polymerase II (IBA) regulation of type B pancreatic cell proliferation (IMP) response to hydrogen peroxide (ISO) response to peptide hormone (IEP) semicircular canal morphogenesis (ISO) smooth muscle cell apoptotic process (ISO) vestibular reflex (ISO)
Molecular Function
cAMP response element binding (ISO,ISS) DNA binding (IDA,IEA) DNA-binding transcription activator activity (ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,IEA,ISO) DNA-binding transcription factor activity (IEA) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) histone acetyltransferase binding (ISO) metal ion binding (IEA) nuclear glucocorticoid receptor binding (IBA,IPI) nuclear receptor activity (IEA) protein binding (IPI,ISO) protein homodimerization activity (IDA) protein kinase binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO) sequence-specific DNA binding (IEA,ISO) transcription coactivator binding (ISO) zinc ion binding (IEA)
1.
The orphan receptor NOR1 participates in isoprenaline-induced cardiac hypertrophy by regulating PARP-1.
Feng XJ, etal., Br J Pharmacol. 2015 Jun;172(11):2852-63. doi: 10.1111/bph.13091. Epub 2015 Mar 26.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Heterodimerization between members of the Nur subfamily of orphan nuclear receptors as a novel mechanism for gene activation.
Maira M, etal., Mol Cell Biol. 1999 Nov;19(11):7549-57.
4.
Protein-protein interactions and transcriptional antagonism between the subfamily of NGFI-B/Nur77 orphan nuclear receptors and glucocorticoid receptor.
Martens C, etal., Mol Endocrinol. 2005 Apr;19(4):885-97. Epub 2004 Dec 9.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Molecular cloning of a novel thyroid/steroid receptor superfamily gene from cultured rat neuronal cells.
Ohkura N, etal., Biochem Biophys Res Commun 1994 Dec 30;205(3):1959-65.
8.
NOR-2 (neuron-derived orphan receptor), a brain zinc finger protein, is highly induced during liver regeneration.
Petropoulos I, etal., FEBS Lett. 1995 Sep 25;372(2-3):273-8.
9.
TIF1beta/KAP-1 is a coactivator of the orphan nuclear receptor NGFI-B/Nur77.
Rambaud J, etal., J Biol Chem. 2009 May 22;284(21):14147-56. doi: 10.1074/jbc.M809023200. Epub 2009 Mar 25.
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Nkx6.1 regulates islet beta-cell proliferation via Nr4a1 and Nr4a3 nuclear receptors.
Tessem JS, etal., Proc Natl Acad Sci U S A. 2014 Apr 8;111(14):5242-7. doi: 10.1073/pnas.1320953111. Epub 2014 Mar 24.
Nr4a3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 67,157,141 - 67,198,287 (+) NCBI GRCr8 mRatBN7.2 5 62,361,588 - 62,401,489 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 62,361,822 - 62,402,733 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 64,336,680 - 64,376,440 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 66,155,972 - 66,195,731 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 66,125,439 - 66,165,198 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 63,781,801 - 63,822,890 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 63,781,801 - 63,821,637 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 68,298,772 - 68,339,861 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 64,713,468 - 64,753,311 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 64,718,506 - 64,758,343 (+) NCBI Celera 5 65,193,786 - 65,233,628 (-) NCBI Celera Cytogenetic Map 5 q22 NCBI
NR4A3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 99,821,885 - 99,866,891 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 99,821,855 - 99,866,891 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 102,584,167 - 102,629,173 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 101,623,958 - 101,668,994 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 99,668,563 - 99,708,728 NCBI Celera 9 73,097,532 - 73,142,572 (+) NCBI Celera Cytogenetic Map 9 q31.1 NCBI HuRef 9 72,183,339 - 72,228,487 (+) NCBI HuRef CHM1_1 9 102,730,616 - 102,775,645 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 111,993,520 - 112,038,527 (+) NCBI T2T-CHM13v2.0
Nr4a3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 48,045,098 - 48,086,446 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 48,045,153 - 48,086,447 (+) Ensembl GRCm39 Ensembl GRCm38 4 48,045,078 - 48,086,447 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 48,045,153 - 48,086,447 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 48,064,120 - 48,096,224 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 48,072,348 - 48,104,452 (+) NCBI MGSCv36 mm8 Celera 4 48,073,263 - 48,105,416 (+) NCBI Celera Cytogenetic Map 4 B1 NCBI cM Map 4 26.07 NCBI
Nr4a3 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 25,779,178 - 25,818,706 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 25,779,368 - 25,817,445 (-) NCBI ChiLan1.0 ChiLan1.0
NR4A3 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 39,597,195 - 39,640,348 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 39,599,566 - 39,642,716 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 70,907,056 - 70,950,221 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 99,028,151 - 99,049,949 (+) NCBI panpan1.1 PanPan1.1 panPan2
NR4A3 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 56,806,506 - 56,846,997 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 56,812,804 - 56,847,689 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 55,238,295 - 55,278,535 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 57,915,798 - 57,956,020 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 57,915,647 - 57,955,434 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 56,420,068 - 56,460,272 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 56,444,924 - 56,485,181 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 57,144,349 - 57,184,553 (+) NCBI UU_Cfam_GSD_1.0
Nr4a3 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 171,704,489 - 171,743,204 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936524 8,252,381 - 8,289,157 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936524 8,252,321 - 8,290,747 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NR4A3 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 241,570,010 - 241,611,727 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 241,569,867 - 241,611,735 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 269,813,286 - 269,852,707 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NR4A3 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 39,568,085 - 39,611,704 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 39,567,852 - 39,606,837 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 2,937,605 - 2,981,244 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nr4a3 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 438 Count of miRNA genes: 234 Interacting mature miRNAs: 323 Transcripts: ENSRNOT00000008302 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578776 Stresp18 Stress response QTL 18 2.9 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 5 27955440 72955440 Rat 1298067 Scl15 Serum cholesterol level QTL 15 4.8 0.001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 33215665 78215665 Rat 1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1358353 Srcrtb2 Stress Responsive Cort Basal QTL 2 3.48 0.003 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 18873947 74251464 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1598807 Glom12 Glomerulus QTL 12 2.7 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 33215665 78215665 Rat 1302786 Kidm8 Kidney mass QTL 8 28.15 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 33215665 78215665 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 6903292 Stl28 Serum triglyceride level QTL 28 2.6 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 5 28515489 73515489 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1578767 Stresp17 Stress response QTL 17 4.3 0.01 blood aldosterone amount (VT:0005346) plasma aldosterone level (CMO:0000551) 5 27955440 72955440 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 1641922 Alcrsp8 Alcohol response QTL 8 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 5 35189153 68564008 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 6903306 Scl35 Serum cholesterol QTL 35 2.6 0.0073 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 28515489 73515489 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 8552954 Pigfal14 Plasma insulin-like growth factor 1 level QTL 14 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 21226744 66226744 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 1600358 Mamtr5 Mammary tumor resistance QTL 5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 18873947 63873947 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
D5Wox30
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 67,196,634 - 67,196,783 (+) Marker Load Pipeline mRatBN7.2 5 62,401,082 - 62,401,231 (+) MAPPER mRatBN7.2 Rnor_6.0 5 63,821,238 - 63,821,386 NCBI Rnor6.0 Rnor_5.0 5 68,338,209 - 68,338,357 UniSTS Rnor5.0 RGSC_v3.4 5 64,752,905 - 64,753,053 UniSTS RGSC3.4 Celera 5 65,194,044 - 65,194,192 UniSTS Cytogenetic Map 5 q22 UniSTS
PMC133552P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 62,368,056 - 62,368,486 (+) MAPPER mRatBN7.2 Rnor_6.0 5 63,788,213 - 63,788,642 NCBI Rnor6.0 Rnor_5.0 5 68,305,184 - 68,305,613 UniSTS Rnor5.0 RGSC_v3.4 5 64,719,880 - 64,720,309 UniSTS RGSC3.4 Celera 5 65,226,787 - 65,227,216 UniSTS Cytogenetic Map 5 q22 UniSTS
RH141611
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 62,400,896 - 62,401,113 (+) MAPPER mRatBN7.2 Rnor_6.0 5 63,821,052 - 63,821,268 NCBI Rnor6.0 Rnor_5.0 5 68,338,023 - 68,338,239 UniSTS Rnor5.0 RGSC_v3.4 5 64,752,719 - 64,752,935 UniSTS RGSC3.4 Celera 5 65,194,162 - 65,194,378 UniSTS RH 3.4 Map 5 413.0 UniSTS Cytogenetic Map 5 q22 UniSTS
BF390776
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 62,402,511 - 62,402,678 (+) MAPPER mRatBN7.2 Rnor_6.0 5 63,822,667 - 63,822,833 NCBI Rnor6.0 Rnor_5.0 5 68,339,638 - 68,339,804 UniSTS Rnor5.0 RGSC_v3.4 5 64,754,334 - 64,754,500 UniSTS RGSC3.4 Celera 5 65,192,598 - 65,192,764 UniSTS RH 3.4 Map 5 416.7 UniSTS Cytogenetic Map 5 q22 UniSTS
PMC133552P2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 67,164,788 - 67,165,141 (+) Marker Load Pipeline mRatBN7.2 5 62,369,234 - 62,369,588 (+) MAPPER mRatBN7.2 Rnor_6.0 5 63,789,391 - 63,789,744 NCBI Rnor6.0 Rnor_5.0 5 68,306,362 - 68,306,715 UniSTS Rnor5.0 RGSC_v3.4 5 64,721,058 - 64,721,411 UniSTS RGSC3.4 Celera 5 65,225,685 - 65,226,038 UniSTS Cytogenetic Map 5 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
67
66
35
25
35
6
194
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000008302 ⟹ ENSRNOP00000008302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 62,361,822 - 62,402,733 (+) Ensembl Rnor_6.0 Ensembl 5 63,781,801 - 63,821,637 (+) Ensembl
RefSeq Acc Id:
NM_031628 ⟹ NP_113816
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,157,198 - 67,197,041 (+) NCBI mRatBN7.2 5 62,361,645 - 62,401,489 (+) NCBI Rnor_6.0 5 63,781,801 - 63,821,644 (+) NCBI Rnor_5.0 5 68,298,772 - 68,339,861 (+) NCBI RGSC_v3.4 5 64,713,468 - 64,753,311 (+) RGD Celera 5 65,193,786 - 65,233,628 (-) RGD
Sequence:
CCGAGTCTCCTGCCTCCCGCCCCCCACCCCTCCAGCGCCTGCTCCTCCTCCGCTCCCCATACACAGACACGCTCACACCCGCTCCTTCACTTGCACACACAGACACACGCGCGCTCACACGCTCCGCA CACACACTCCACTCTCTCCCGCGCGCTCACACCCCTCTCTCTCGGCGCCCTCGCCGGTGTCGCGCCGCGCCGCGCCGCAGCCGGACGCCCCTCCAGGGCTCACTTTGCAACGCTGACAGAGCGGGCAG TGGCCGTGGAGGTGGGAAACGTGGCGACATCCTAGCCCCTGGTCGCAGCCGGAGACTGGACGCTGCGGAACCTCTCGGCGGCGCTCTCCCATGAGTTGGGATCGCAGCATCCCCAGCCAGCCGCTGCT CACCGCCTCTGGGAGCCGCTGGGTTTGTGCACCGCAGCCCTTCCGGGACAGCAGCTGTGACTCTCCCCCAATCCAGATTTCGGGGTCGCTCTCTAGAAACTCGCTCTAAAGACGGAACCTCCACAGAA CCCAAAGCCCACTGCGGGAGAGCGCAGCCCGACAAGCCCGGGCGCTGAGCCTGGACCCTCAACAGAGCGGGCCAGCACAGCGGCGGCGGCTGCTTCGCCTATCCCGACGTCCCCGCCTCCTACACTCT CAGCCTCCGCTGGAGAGACCCCCAGCCCCACCATTCAGCGCGCAAGATACCCTCCAGATATGCCCTGCGTGCAAGCCCAATATAGCCCTTCGCCTCCGGGGTCCACTTATGCCACGCAGACTTATGGC TCGGAATACACCACAGAAATCATGAACCCCGACTATGCCAAGCTGACCATGGACCTCGGTAGCACGGGGATCATGGCCACGGCCACGACGTCCCTGCCCAGCTTCAGTACCTTCATGGAGGGCTACCC CAGCAGCTGCGAACTCAAGCCCTCCTGCCTGTACCAAATGCCGCCTTCTGGGCCTCGGCCTTTGATCAAGATGGAAGAGGGTCGCGAGCATGGCTACCACCACCACCACCACCATCACCATCATCATC ACCACCACCACCAGCAGCAGCAGCCGTCCATTCCTCCTCCCTCTGGCCCCGAGGACGAGGTACTGCCCAGCACCTCCATGTACTTCAAGCAGTCTCCGCCGTCTACGCCGACCACTCCAGGCTTCCCC CCGCAGGCGGGGGCGCTGTGGGACGACGAGCTGCCCTCTGCGCCTGGCTGCATCGCTCCGGGACCGCTGCTGGACCCGCAGATGAAGGCAGTGCCCCCAATGGCCGCTGCTGCGCGCTTCCCGATCTT CTTCAAGCCCTCACCGCCACACCCTCCCGCGCCCAGCCCAGCCGGCGGCCACCACCTGGGCTATGACCCCACGGCCGCAGCTGCGCTCAGTCTACCCCTGGGAGCCGCGGCCGCCGCGGGCAGCCAAG CTGCTGCGCTCGAGGGCCATCCGTACGGGCTCCCGCTGGCCAAGAGGACGGCCACGTTGACCTTCCCTCCGCTGGGCCTCACAGCGTCCCCTACCGCGTCCAGCCTGCTGGGAGAGAGCCCCAGCCTA CCATCGCCACCCAATAGGAGCTCATCATCCGGCGAGGGCACGTGTGCTGTGTGCGGGGACAATGCTGCCTGCCAGCACTACGGAGTCCGCACCTGCGAGGGCTGCAAGGGCTTCTTCAAGAGAACGGT GCAGAAAAACGCAAAATATGTTTGCTTGGCAAATAAAAACTGCCCGGTAGACAAGAGACGTCGAAATCGATGTCAGTACTGCAGGTTTCAGAAGTGTCTCAGTGTCGGGATGGTGAAGGAAGTTGTGC GTACAGATAGTCTGAAAGGGAGGAGAGGTCGTCTGCCTTCCAAACCAAAGAGCCCACTACAACAGGAGCCCTCGCAGCCCTCCCCACCATCTCCTCCGATCTGTATGATGAACGCCCTTGTCCGAGCT TTAACAGACGCAACGCCCAGAGACCTTGATTACTCCAGATACTGTCCCACCGACCAGGCCACTGCGGGCACAGACGCTGAGCACGTGCAGCAGTTCTACAACCTTCTGACGGCCTCCATCGACGTGTC CAGAAGCTGGGCAGAAAAGATCCCCGGATTCACTGATCTCCCCAAAGAAGATCAGACGTTACTTATAGAATCAGCCTTTTTGGAGCTGTTCGTTCTTAGACTTTCTATCAGGTCAAACACTGCTGAAG ATAAGTTTGTGTTCTGCAATGGACTTGTCCTGCACCGACTTCAGTGCCTTCGCGGATTTGGGGAGTGGCTCGACTCCATTAAAGACTTTTCTTTAAATTTGCAGAGCCTGAACCTTGATATCCAAGCC TTAGCCTGCCTGTCAGCACTGAGTATGATCACAGAGCGACATGGGTTAAAAGAACCAAAGAGAGTGGAGGAGCTATGCAACAAGATCACAAGCAGCTTAAAGGACCACCAGAGGAAGGGACAGGCTCT GGAGCCCTCAGAGCCCAAGGTCCTTCGCGCACTGGTGGAACTGAGGAAGATCTGCACCCAGGGCCTCCAGCGTATCTTCTACCTGAAGCTGGAGGACTTGGTGTCCCCACCTTCTGTCATCGACAAGC TCTTCCTTGATACCCTGCCTTTCTGAGCAGGGGAAGCCTGAGCAGAGAGCTACTTGCTCTGCTGGCACTGGTCATTAAGTGAGCAAAAGGATGGGTTTGAACACCTGCCCCTCTATCCTTCCTCCAGG GGAAAAAGCAGCTCCCATAGAAAGCAAAGACTTTTTTTTTTCCTGGCACCTTTCCTTACAACCTAAAGCCAGAAACCTTGCAGAGTATTGTGTTGGGGTTGTGTTTTATATTTAGGCTTTGGTGGGTG GGCTGGGAGGGGGTAAAATAGTTCATGAGGCTTTTCTAAGAAATTGCTGACGAAGCACTTTTGGATGATGCTATCCCAGCAGTGGGGTGGGGAGAAAGGATAATATAACTGTTTTAAAAACTCTTTCC GGGGGAATATGACTATGGTTGCTTTGTATTTAAAAATAAGAACAGCCAAGGGCTGTTTTACCAGGGTAGGGCTGTGTCTTAAGACTGATCCCTTTAGTATGTACTTCCCGGATCGAGGCACATAAGTG GTGCAAATGAGGCGGGGAAATTCTTCATTTCTTCATTTCTTTCTTCTTCTTAAAATAAAATGGCAAAAAAAAAAAGATGGAAGATTATCTACAAATCAGACTTAGCAAAATGATAATGGCTATTCGCT TCCACATACAAGTGCAATTTTTTAGAGTGCTGTCTTACTAAGTCTTGTTTGTGAACTCTCCCTCATTTTATATGAAAATAAGAAGGAGGCAGTCATGTTATCAAACGGCGTGCTCATTTTCCTAGCTC ACCCTTGGTCCACCTGCCCTGTAGAACCCTTCGGAGGTATGGCCCTTCTAAGACTTTCAGGCCACTCTTGATGGAATTCGACACCCCTCCCCTCAACCCATGACTATCCAGATGTCCTGAATGGGGAT CAGGTTATAAAATGGATTGCATATGACTGTGTTCGCTGTGTGTTTGTCAACCTGGACAGAGTTCTCTAAACCTTCTTTAGTTGTAGCAAGTTCCTGATTCCTCCATTCAGAAGCCCAAGGAGCATTGG GTGACTCGATCAAGGGTTAACCCTAGGAGAACATGCAAATAAGTAGGAACTGGGTCAGACAGGGTAAGCACCAGAGATGATAAGGATTTATATATAAATATATATAAAATTAATTTTTGTTATTGGTT ATAGACAATTTTGGAAAGCAAGAGAATCATCTCTTTTTTTTTTTTAAAGAGGAAAAGATAGTATTGATGTATTAGCAAAGATTAGTGGGGTACGGTTCAACATTCCGTGTTTGTGCCCCCTTTTCTAT GTTTCTACTGTTGATGGCATATTATTATGAAATGATTCGTTGCATAGTGTCCTTATTTGTATGAACATTTGTATGCACGTTCTATTGTAATCGCTTTGCCTGTATTTATTGCAAGACCACCAGCTCCT GGAGGCTGAGTTACAGAATAATCAAATGGGGTGTTCGTGGTGACTTGGATACACCGGTTAGAAATTAAATAAGCATATATATATATATAAAAACATAGCAGGTTACATATATATTTATAATGTGTCTT TTTATTAACCATTTGTACAATAAATGTCACTTCCCACGCAGTTATTTTATCCTTTGTTTGCAGTGACCTTTAAGGCAGCACTGTTTAGCACTTTGATATGAAATTTTTTGCTTATTTTTTTGCTAAAT TCAAATAACGTTTGAAGATTTTTAGGTCTAAAAGTCTTTATATTATATACACTGTATCAAGTCAAGATACCTTTGGCCGTTTTGCTAAGACTCAAACTTTGAATGTCAAACCAATGTCACGGTAGCTT CTGTTAGCTTTTAATCATTTTTGCTTTAGTCTTTTTTTTTAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039110691 ⟹ XP_038966619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,157,141 - 67,198,287 (+) NCBI mRatBN7.2 5 62,361,588 - 62,399,680 (+) NCBI
RefSeq Acc Id:
XM_039110692 ⟹ XP_038966620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,158,042 - 67,198,287 (+) NCBI mRatBN7.2 5 62,362,196 - 62,399,680 (+) NCBI
RefSeq Acc Id:
XM_063288331 ⟹ XP_063144401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 67,161,973 - 67,198,287 (+) NCBI
RefSeq Acc Id:
NP_113816 ⟸ NM_031628
- UniProtKB:
Q63516 (UniProtKB/Swiss-Prot), Q2XPY2 (UniProtKB/Swiss-Prot), Q9QWQ3 (UniProtKB/Swiss-Prot), P51179 (UniProtKB/Swiss-Prot), A6KJG2 (UniProtKB/TrEMBL)
- Sequence:
MPCVQAQYSPSPPGSTYATQTYGSEYTTEIMNPDYAKLTMDLGSTGIMATATTSLPSFSTFMEGYPSSCELKPSCLYQMPPSGPRPLIKMEEGREHGYHHHHHHHHHHHHHHQQQQPSIPPPSGPEDE VLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDELPSAPGCIAPGPLLDPQMKAVPPMAAAARFPIFFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALEGHPYGLPLAKRTATL TFPPLGLTASPTASSLLGESPSLPSPPNRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPL QQEPSQPSPPSPPICMMNALVRALTDATPRDLDYSRYCPTDQATAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGF GEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQRKGQALEPSEPKVLRALVELRKICTQGLQRIFYLKLEDLVSPPSVIDKLFLDTLPF
hide sequence
Ensembl Acc Id:
ENSRNOP00000008302 ⟸ ENSRNOT00000008302
RefSeq Acc Id:
XP_038966619 ⟸ XM_039110691
- Peptide Label:
isoform X1
- UniProtKB:
Q63516 (UniProtKB/Swiss-Prot), Q2XPY2 (UniProtKB/Swiss-Prot), P51179 (UniProtKB/Swiss-Prot), Q9QWQ3 (UniProtKB/Swiss-Prot), A6KJG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966620 ⟸ XM_039110692
- Peptide Label:
isoform X1
- UniProtKB:
Q63516 (UniProtKB/Swiss-Prot), Q2XPY2 (UniProtKB/Swiss-Prot), P51179 (UniProtKB/Swiss-Prot), Q9QWQ3 (UniProtKB/Swiss-Prot), A6KJG2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144401 ⟸ XM_063288331
- Peptide Label:
isoform X1
- UniProtKB:
Q9QWQ3 (UniProtKB/Swiss-Prot), Q63516 (UniProtKB/Swiss-Prot), Q2XPY2 (UniProtKB/Swiss-Prot), P51179 (UniProtKB/Swiss-Prot), A6KJG2 (UniProtKB/TrEMBL)
RGD ID: 13693723
Promoter ID: EPDNEW_R4247
Type: single initiation site
Name: Nr4a3_1
Description: nuclear receptor subfamily 4, group A, member 3
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 63,781,889 - 63,781,949 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Nr4a3
nuclear receptor subfamily 4, group A, member 3
Name updated
70584
APPROVED
Note Type
Note
Reference
gene_function
binds to the B1a response-element
61676