Symbol:
Psma7
Name:
proteasome 20S subunit alpha 7
RGD ID:
61851
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be part of proteasome core complex, alpha-subunit complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human PSMA7 (proteasome 20S subunit alpha 7); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 2-nitrofluorene; 4,4'-sulfonyldiphenol; 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-4; MGC156537; proteasome (prosome, macropain) subunit, alpha type 7; proteasome subunit alpha 7; proteasome subunit alpha type-7; proteasome subunit alpha-4; proteasome subunit RC6-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PSMA7 (proteasome 20S subunit alpha 7) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Psma7 (proteasome subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Psma7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PSMA7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PSMA7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Psma7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PSMA7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PSMA7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Psma7 (proteasome 20S subunit alpha 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PSMA8 (proteasome 20S subunit alpha 8) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Psma7 (proteasome subunit alpha 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PSMA7 (proteasome 20S subunit alpha 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PRE6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Prosalpha4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Prosalpha4T1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Prosalpha4T2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
pas-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
psma7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 187,514,901 - 187,521,289 (-) NCBI GRCr8 mRatBN7.2 3 167,137,279 - 167,143,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 167,137,263 - 167,143,672 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 171,514,522 - 171,520,711 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 180,473,605 - 180,479,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 177,137,114 - 177,143,297 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 175,420,042 - 175,426,384 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 175,420,039 - 175,426,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 181,692,298 - 181,698,641 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 169,100,807 - 169,107,149 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 169,006,842 - 169,013,159 (-) NCBI Celera 3 165,436,256 - 165,442,444 (+) NCBI Celera Cytogenetic Map 3 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psma7 Rat (-)-epigallocatechin 3-gallate increases expression ISO PSMA7 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PSMA7 protein CTD PMID:31195006 Psma7 Rat (1->4)-beta-D-glucan multiple interactions ISO Psma7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMA7 mRNA CTD PMID:36331819 Psma7 Rat 1,2-dimethylhydrazine multiple interactions ISO Psma7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMA7 mRNA CTD PMID:22206623 Psma7 Rat 17alpha-ethynylestradiol multiple interactions ISO Psma7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMA7 mRNA CTD PMID:17942748 Psma7 Rat 17beta-estradiol increases expression ISO Psma7 (Mus musculus) 6480464 Estradiol results in increased expression of PSMA7 mRNA CTD PMID:39298647 Psma7 Rat 1H-pyrazole increases expression ISO Psma7 (Mus musculus) 6480464 pyrazole results in increased expression of PSMA7 mRNA CTD PMID:17945193 Psma7 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psma7 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psma7 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psma7 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMA7 mRNA CTD PMID:17942748 Psma7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Psma7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PSMA7 mRNA CTD PMID:21570461 Psma7 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat 3H-1,2-dithiole-3-thione increases expression ISO Psma7 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PSMA7 mRNA CTD PMID:15375163 Psma7 Rat 4,4'-sulfonyldiphenol increases expression ISO Psma7 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMA7 mRNA CTD PMID:39298647 Psma7 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PSMA7 mRNA CTD PMID:36041667 Psma7 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PSMA7 mRNA CTD PMID:30047161 Psma7 Rat acrolein multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PSMA7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PSMA7 mRNA CTD PMID:32699268 Psma7 Rat acrylamide increases expression ISO PSMA7 (Homo sapiens) 6480464 Acrylamide results in increased expression of PSMA7 mRNA CTD PMID:32763439 Psma7 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat aflatoxin B1 increases methylation ISO PSMA7 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PSMA7 gene CTD PMID:27153756 Psma7 Rat all-trans-retinoic acid increases expression ISO PSMA7 (Homo sapiens) 6480464 Tretinoin results in increased expression of PSMA7 mRNA CTD PMID:17218384 Psma7 Rat alpha-pinene multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PSMA7 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PSMA7 mRNA CTD PMID:32699268 Psma7 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PSMA7 mRNA CTD PMID:30047161 Psma7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMA7 mRNA CTD PMID:16483693 Psma7 Rat arsane multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMA7 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA7 mRNA CTD PMID:35809665 and PMID:39836092 Psma7 Rat arsenic atom multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMA7 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA7 mRNA CTD PMID:35809665 and PMID:39836092 Psma7 Rat arsenic trichloride multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PSMA7 mRNA CTD PMID:35809665 Psma7 Rat arsenous acid increases expression ISO PSMA7 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMA7 mRNA CTD PMID:29633893 Psma7 Rat atrazine increases expression ISO PSMA7 (Homo sapiens) 6480464 Atrazine results in increased expression of PSMA7 mRNA CTD PMID:22378314 Psma7 Rat benzo[a]pyrene increases expression ISO Psma7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMA7 mRNA CTD PMID:19770486 Psma7 Rat benzo[a]pyrene increases methylation ISO Psma7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PSMA7 promoter CTD PMID:27901495 Psma7 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PSMA7 mRNA CTD PMID:21839799 Psma7 Rat benzo[b]fluoranthene increases expression ISO Psma7 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PSMA7 mRNA CTD PMID:26377693 Psma7 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMA7 mRNA CTD PMID:21318169 Psma7 Rat bis(2-ethylhexyl) phthalate increases expression ISO Psma7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PSMA7 mRNA CTD PMID:33754040 Psma7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMA7 mRNA CTD PMID:25181051 more ... Psma7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PSMA7 mRNA CTD PMID:36041667 Psma7 Rat bisphenol A increases expression ISO Psma7 (Mus musculus) 6480464 bisphenol A results in increased expression of PSMA7 mRNA CTD PMID:32156529 more ... Psma7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PSMA7 mRNA CTD PMID:33296240 Psma7 Rat bisphenol A decreases expression ISO PSMA7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMA7 mRNA and bisphenol A results in decreased expression of PSMA7 protein CTD PMID:29275510 and PMID:34186270 Psma7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PSMA7 gene CTD PMID:28505145 Psma7 Rat bisphenol AF increases expression ISO PSMA7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMA7 protein CTD PMID:34186270 Psma7 Rat Bisphenol B increases expression ISO PSMA7 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMA7 protein CTD PMID:34186270 Psma7 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of PSMA7 mRNA CTD PMID:36041667 Psma7 Rat bisphenol F increases expression ISO PSMA7 (Homo sapiens) 6480464 bisphenol F results in increased expression of PSMA7 protein CTD PMID:34186270 Psma7 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PSMA7 mRNA CTD PMID:19167457 Psma7 Rat chlorpyrifos decreases expression ISO Psma7 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PSMA7 mRNA CTD PMID:37019170 Psma7 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of PSMA7 mRNA CTD PMID:21318169 Psma7 Rat cyclosporin A increases expression ISO PSMA7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMA7 mRNA CTD PMID:20106945 Psma7 Rat diarsenic trioxide increases expression ISO PSMA7 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMA7 mRNA CTD PMID:29633893 Psma7 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat dioxygen decreases expression ISO Psma7 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of PSMA7 protein CTD PMID:25937538 Psma7 Rat disodium selenite increases expression ISO PSMA7 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PSMA7 mRNA CTD PMID:18175754 Psma7 Rat doxorubicin increases metabolic processing ISO PSMA7 (Homo sapiens) 6480464 Doxorubicin results in increased metabolism of PSMA7 protein CTD PMID:17346995 Psma7 Rat doxorubicin increases expression ISO PSMA7 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PSMA7 mRNA CTD PMID:29803840 Psma7 Rat epoxiconazole affects expression ISO Psma7 (Mus musculus) 6480464 epoxiconazole affects the expression of PSMA7 mRNA CTD PMID:35436446 Psma7 Rat ethanol affects expression ISO Psma7 (Mus musculus) 6480464 Ethanol affects the expression of PSMA7 mRNA CTD PMID:30319688 Psma7 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMA7 mRNA CTD PMID:24136188 Psma7 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PSMA7 mRNA CTD PMID:34044035 Psma7 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMA7 mRNA CTD PMID:24136188 Psma7 Rat folic acid multiple interactions ISO Psma7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMA7 mRNA CTD PMID:22206623 Psma7 Rat furan increases methylation EXP 6480464 furan results in increased methylation of PSMA7 gene CTD PMID:22079235 Psma7 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PSMA7 mRNA CTD PMID:22061828 Psma7 Rat hypochlorous acid increases expression ISO Psma7 (Mus musculus) 6480464 Hypochlorous Acid results in increased expression of PSMA7 mRNA CTD PMID:19376150 Psma7 Rat inulin multiple interactions ISO Psma7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PSMA7 mRNA CTD PMID:36331819 Psma7 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of PSMA7 mRNA CTD PMID:30303030 Psma7 Rat isotretinoin decreases expression ISO PSMA7 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PSMA7 mRNA CTD PMID:20436886 Psma7 Rat ivermectin decreases expression ISO PSMA7 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMA7 protein CTD PMID:32959892 Psma7 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PSMA7 mRNA CTD PMID:30047161 Psma7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO PSMA7 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PSMA7 mRNA CTD PMID:38685446 Psma7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMA7 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMA7 mRNA CTD PMID:31806706 Psma7 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PSMA7 mRNA CTD PMID:20360939 Psma7 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PSMA7 mRNA CTD PMID:15890375 Psma7 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMA7 mRNA CTD PMID:24136188 Psma7 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMA7 mRNA CTD PMID:24136188 Psma7 Rat nitrates multiple interactions ISO Psma7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PSMA7 mRNA CTD PMID:35964746 Psma7 Rat ozone multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PSMA7 mRNA more ... CTD PMID:32699268 and PMID:35430440 Psma7 Rat ozone multiple interactions ISO Psma7 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PSMA7 mRNA CTD PMID:27106289 Psma7 Rat patulin multiple interactions ISO Psma7 (Mus musculus) 6480464 NFE2L1 protein affects the reaction [Patulin results in increased expression of PSMA7 mRNA] CTD PMID:35367319 Psma7 Rat patulin increases expression ISO Psma7 (Mus musculus) 6480464 Patulin results in increased expression of PSMA7 mRNA CTD PMID:35367319 Psma7 Rat pentachlorophenol increases expression ISO Psma7 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PSMA7 mRNA CTD PMID:23892564 Psma7 Rat perfluorooctane-1-sulfonic acid affects expression ISO Psma7 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PSMA7 mRNA CTD PMID:19429403 Psma7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psma7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMA7 mRNA more ... CTD PMID:36331819 Psma7 Rat perfluorooctane-1-sulfonic acid increases expression ISO Psma7 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMA7 mRNA CTD PMID:20936131 Psma7 Rat perfluorooctanoic acid affects expression ISO Psma7 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PSMA7 mRNA CTD PMID:19429403 Psma7 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PSMA7 mRNA CTD PMID:19162173 and PMID:21318169 Psma7 Rat perfluorooctanoic acid increases expression ISO Psma7 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PSMA7 mRNA CTD PMID:18467677 and PMID:21318169 Psma7 Rat perfluorooctanoic acid multiple interactions ISO Psma7 (Mus musculus) 6480464 PPARA protein affects the reaction [perfluorooctanoic acid results in increased expression of PSMA7 mRNA] and PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of PSMA7 mRNA] CTD PMID:18467677 and PMID:21318169 Psma7 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of PSMA7 mRNA CTD PMID:20360939 Psma7 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMA7 mRNA CTD PMID:19162173 and PMID:21318169 Psma7 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMA7 mRNA CTD PMID:15890375 and PMID:22484513 Psma7 Rat pirinixic acid multiple interactions ISO Psma7 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of PSMA7 mRNA] CTD PMID:21318169 Psma7 Rat pirinixic acid increases expression ISO Psma7 (Mus musculus) 6480464 pirinixic acid results in increased expression of PSMA7 mRNA CTD PMID:15375163 more ... Psma7 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PSMA7 mRNA CTD PMID:15890375 more ... Psma7 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PSMA7 mRNA CTD PMID:19162173 and PMID:21318169 Psma7 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PSMA7 mRNA CTD PMID:30047161 Psma7 Rat resveratrol multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PSMA7 mRNA CTD PMID:23557933 Psma7 Rat rotenone decreases expression ISO Psma7 (Mus musculus) 6480464 Rotenone results in decreased expression of PSMA7 mRNA CTD PMID:23186747 Psma7 Rat sodium arsenite increases expression ISO PSMA7 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PSMA7 mRNA CTD PMID:34032870 Psma7 Rat sodium arsenite multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA7 mRNA CTD PMID:39836092 Psma7 Rat sodium fluoride decreases expression ISO Psma7 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PSMA7 protein CTD PMID:28918527 Psma7 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PSMA7 mRNA CTD PMID:30047161 Psma7 Rat sulfasalazine decreases expression EXP 6480464 Sulfasalazine results in decreased expression of PSMA7 protein CTD PMID:15928459 Psma7 Rat tanespimycin multiple interactions ISO PSMA7 (Homo sapiens) 6480464 [tanespimycin co-treated with VER 155008] results in increased expression of PSMA7 protein CTD PMID:31370342 Psma7 Rat tetrachloromethane increases expression ISO Psma7 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PSMA7 mRNA CTD PMID:31919559 Psma7 Rat titanium dioxide decreases methylation ISO Psma7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PSMA7 gene CTD PMID:35295148 Psma7 Rat triphenyl phosphate affects expression ISO PSMA7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PSMA7 mRNA CTD PMID:37042841 Psma7 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMA7 mRNA CTD PMID:24136188 Psma7 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMA7 mRNA CTD PMID:21318169
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-nitrofluorene (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenic trichloride (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) C60 fullerene (EXP) chlorpyrifos (ISO) clofibrate (EXP) cyclosporin A (ISO) diarsenic trioxide (ISO) diethylstilbestrol (EXP) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) furan (EXP) gentamycin (EXP) hypochlorous acid (ISO) inulin (ISO) isoprenaline (EXP) isotretinoin (ISO) ivermectin (ISO) methapyrilene (EXP) methimazole (EXP) mono(2-ethylhexyl) phthalate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) ozone (ISO) patulin (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenethyl caffeate (EXP) phenobarbital (EXP) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) resveratrol (ISO) rotenone (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sulfasalazine (EXP) tanespimycin (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) valdecoxib (EXP) valproic acid (EXP)
Cellular Component
cytoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) proteasome complex (IEA,ISO) proteasome core complex (IEA,ISO,ISS) proteasome core complex, alpha-subunit complex (IBA,IEA,ISO,ISS)
Psma7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 187,514,901 - 187,521,289 (-) NCBI GRCr8 mRatBN7.2 3 167,137,279 - 167,143,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 167,137,263 - 167,143,672 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 171,514,522 - 171,520,711 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 180,473,605 - 180,479,794 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 177,137,114 - 177,143,297 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 175,420,042 - 175,426,384 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 175,420,039 - 175,426,395 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 181,692,298 - 181,698,641 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 169,100,807 - 169,107,149 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 169,006,842 - 169,013,159 (-) NCBI Celera 3 165,436,256 - 165,442,444 (+) NCBI Celera Cytogenetic Map 3 q43 NCBI
PSMA7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 62,136,733 - 62,143,394 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 62,136,733 - 62,143,440 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 60,711,789 - 60,718,450 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 60,145,186 - 60,151,869 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 60,145,185 - 60,151,869 NCBI Celera 20 57,446,966 - 57,453,645 (-) NCBI Celera Cytogenetic Map 20 q13.33 NCBI HuRef 20 57,489,262 - 57,493,481 (-) NCBI HuRef CHM1_1 20 60,612,850 - 60,619,583 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 63,927,604 - 63,934,261 (-) NCBI T2T-CHM13v2.0
Psma7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 179,678,160 - 179,684,257 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 179,678,167 - 179,684,226 (-) Ensembl GRCm39 Ensembl GRCm38 2 180,036,367 - 180,042,464 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 180,036,374 - 180,042,433 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 179,771,081 - 179,777,107 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 179,965,784 - 179,971,810 (-) NCBI MGSCv36 mm8 Celera 2 184,120,963 - 184,127,008 (-) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 102.55 NCBI
Psma7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955528 1,883,938 - 1,888,882 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955528 1,882,397 - 1,887,811 (+) NCBI ChiLan1.0 ChiLan1.0
PSMA7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 67,918,126 - 67,924,848 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 67,911,241 - 67,918,017 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 58,502,446 - 58,509,175 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 59,822,545 - 59,826,804 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 59,822,545 - 59,826,802 (-) Ensembl panpan1.1 panPan2
PSMA7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 46,182,344 - 46,186,241 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 46,182,420 - 46,186,079 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 45,419,604 - 45,424,931 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 47,039,071 - 47,044,386 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 47,039,078 - 47,044,368 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 46,140,666 - 46,145,984 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 46,263,612 - 46,268,935 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 47,017,870 - 47,023,195 (-) NCBI UU_Cfam_GSD_1.0
Psma7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 194,355,315 - 194,360,248 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 9,806,624 - 9,813,723 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 9,808,966 - 9,819,548 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMA7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 61,566,373 - 61,572,438 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 61,566,373 - 61,571,516 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 69,076,205 - 69,079,528 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMA7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 2,094,331 - 2,101,069 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 2,094,455 - 2,100,936 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 50,044,223 - 50,050,960 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Psma7
.
Predicted Target Of
Count of predictions: 150 Count of miRNA genes: 125 Interacting mature miRNAs: 139 Transcripts: ENSRNOT00000011724 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1300161 Rf10 Renal function QTL 10 3.57 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 3 161192952 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
RH136620
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 187,514,966 - 187,515,544 (+) Marker Load Pipeline mRatBN7.2 3 167,137,341 - 167,137,920 (+) MAPPER mRatBN7.2 Rnor_6.0 3 175,420,105 - 175,420,683 NCBI Rnor6.0 Rnor_5.0 3 181,698,000 - 181,698,578 UniSTS Rnor5.0 RGSC_v3.4 3 169,100,870 - 169,101,448 UniSTS RGSC3.4 Celera 3 165,441,803 - 165,442,381 UniSTS Cytogenetic Map 3 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000082686 ⟹ ENSRNOP00000071611
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 167,137,280 - 167,143,672 (-) Ensembl Rnor_6.0 Ensembl 3 175,420,039 - 175,426,395 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095041 ⟹ ENSRNOP00000078026
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 167,137,720 - 167,143,650 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106991 ⟹ ENSRNOP00000087849
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 167,137,263 - 167,143,672 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116159 ⟹ ENSRNOP00000097117
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 167,137,280 - 167,143,672 (-) Ensembl
RefSeq Acc Id:
NM_001008217 ⟹ NP_001008218
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 187,514,903 - 187,521,246 (-) NCBI mRatBN7.2 3 167,137,279 - 167,143,626 (-) NCBI Rnor_6.0 3 175,420,042 - 175,426,384 (-) NCBI Rnor_5.0 3 181,692,298 - 181,698,641 (+) NCBI RGSC_v3.4 3 169,100,807 - 169,107,149 (-) RGD Celera 3 165,436,256 - 165,442,444 (+) RGD
Sequence:
GGGGCGCTGAAGGTGAGTGTGCGCTTTTGAGCGGCGGCGGCTTGAGCTCGCGCGTCCGCAGTGATGAGCTACGACCGCGCCATCACCGTCTTCTCGCCCGACGGCCACCTCTTCCAAGTGGAGTACGC
hide sequence
RefSeq Acc Id:
XM_063283532 ⟹ XP_063139602
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 187,514,901 - 187,521,289 (-) NCBI
RefSeq Acc Id:
NP_001008218 ⟸ NM_001008217
- UniProtKB:
A0A0G2K0W9 (UniProtKB/TrEMBL), A6KMC7 (UniProtKB/TrEMBL)
- Sequence:
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFG
hide sequence
Ensembl Acc Id:
ENSRNOP00000071611 ⟸ ENSRNOT00000082686
Ensembl Acc Id:
ENSRNOP00000097117 ⟸ ENSRNOT00000116159
Ensembl Acc Id:
ENSRNOP00000078026 ⟸ ENSRNOT00000095041
Ensembl Acc Id:
ENSRNOP00000087849 ⟸ ENSRNOT00000106991
RefSeq Acc Id:
XP_063139602 ⟸ XM_063283532
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A6N6 (UniProtKB/TrEMBL), A0A8I5Y830 (UniProtKB/TrEMBL)
RGD ID: 13692728 Promoter ID: EPDNEW_R3253 Type: initiation region Name: Psma7_1 Description: proteasome subunit alpha 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 175,426,376 - 175,426,436 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-09-13
Psma7
proteasome 20S subunit alpha 7
Psma7
proteasome subunit alpha 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-08-19
Psma7
proteasome subunit alpha 7
Psma7
proteasome (prosome, macropain) subunit, alpha type 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Psma7
proteasome (prosome, macropain) subunit, alpha type 7
Name updated
70584 APPROVED
