Symbol:
Psma1
Name:
proteasome 20S subunit alpha 1
RGD ID:
61841
Description:
Predicted to enable lipopolysaccharide binding activity. Predicted to be involved in negative regulation of inflammatory response to antigenic stimulus and proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to be located in centrosome and nucleoplasm. Predicted to be part of proteasome core complex, alpha-subunit complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human PSMA1 (proteasome 20S subunit alpha 1); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1-bromopropane; 2,4-dinitrotoluene; 2-nitrofluorene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
macropain subunit C2; multicatalytic endopeptidase complex subunit C2; proteasome (prosome, macropain) subunit, alpha type 1; proteasome alpha 1 subunit; proteasome component C2; proteasome nu chain; proteasome subunit alpha 1; proteasome subunit alpha type-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 177,876,838 - 177,887,857 (-) NCBI GRCr8 mRatBN7.2 1 168,442,421 - 168,453,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,440,936 - 168,453,472 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 176,771,846 - 176,782,862 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 183,957,918 - 183,968,934 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 176,671,909 - 176,682,943 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 183,733,567 - 183,744,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 183,733,567 - 183,744,586 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 190,708,745 - 190,719,764 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,237,763 - 172,248,782 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,373,871 - 172,384,891 (-) NCBI Celera 1 166,294,949 - 166,305,966 (-) NCBI Celera Cytogenetic Map 1 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Psma1 Rat (+)-catechin multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PSMA1 mRNA CTD PMID:24763279 Psma1 Rat (1->4)-beta-D-glucan multiple interactions ISO Psma1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMA1 mRNA CTD PMID:36331819 Psma1 Rat (Z)-3-butylidenephthalide increases expression ISO PSMA1 (Homo sapiens) 6480464 butylidenephthalide results in increased expression of PSMA1 protein CTD PMID:23770345 Psma1 Rat 1,2-dimethylhydrazine multiple interactions ISO Psma1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMA1 mRNA CTD PMID:22206623 Psma1 Rat 1,2-dimethylhydrazine decreases expression ISO Psma1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PSMA1 mRNA CTD PMID:22206623 Psma1 Rat 1-bromopropane decreases expression EXP 6480464 1-bromopropane results in decreased expression of PSMA1 protein CTD PMID:21925529 Psma1 Rat 17alpha-ethynylestradiol affects expression ISO Psma1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PSMA1 mRNA CTD PMID:17555576 Psma1 Rat 17alpha-ethynylestradiol multiple interactions ISO Psma1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMA1 mRNA CTD PMID:17942748 Psma1 Rat 17alpha-ethynylestradiol increases expression ISO Psma1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PSMA1 mRNA CTD PMID:17942748 Psma1 Rat 17beta-estradiol increases expression ISO Psma1 (Mus musculus) 6480464 Estradiol results in increased expression of PSMA1 mRNA CTD PMID:39298647 Psma1 Rat 1H-pyrazole increases expression ISO Psma1 (Mus musculus) 6480464 pyrazole results in increased expression of PSMA1 mRNA CTD PMID:17945193 Psma1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Psma1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Psma1 Rat 2,3,7,8-tetrabromodibenzodioxine increases expression ISO Psma1 (Mus musculus) 6480464 2 more ... CTD PMID:27604104 Psma1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PSMA1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMA1 mRNA CTD PMID:19684285 Psma1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Psma1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PSMA1 mRNA CTD PMID:17942748 Psma1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Psma1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PSMA1 mRNA CTD PMID:19684285 Psma1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PSMA1 mRNA CTD PMID:21346803 Psma1 Rat 2,6-dimethoxyphenol multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in decreased expression of PSMA1 protein CTD PMID:38598786 Psma1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PSMA1 mRNA CTD PMID:28628672 Psma1 Rat 3H-1,2-dithiole-3-thione increases expression ISO Psma1 (Mus musculus) 6480464 1 and 2-dithiol-3-thione results in increased expression of PSMA1 mRNA CTD PMID:15375163 Psma1 Rat 4,4'-sulfonyldiphenol increases expression ISO Psma1 (Mus musculus) 6480464 bisphenol S results in increased expression of PSMA1 mRNA CTD PMID:39298647 Psma1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PSMA1 mRNA CTD PMID:36041667 Psma1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PSMA1 mRNA CTD PMID:30047161 Psma1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of PSMA1 mRNA CTD PMID:15890375 and PMID:33354967 Psma1 Rat aflatoxin B1 increases methylation ISO PSMA1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PSMA1 intron CTD PMID:30157460 Psma1 Rat aflatoxin B1 decreases methylation ISO PSMA1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PSMA1 gene CTD PMID:27153756 Psma1 Rat Aflatoxin B2 alpha increases methylation ISO PSMA1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PSMA1 intron CTD PMID:30157460 Psma1 Rat aldehydo-D-glucose decreases expression ISO PSMA1 (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of PSMA1 protein CTD PMID:22314686 Psma1 Rat all-trans-retinoic acid multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of PSMA1 protein CTD PMID:17098229 Psma1 Rat all-trans-retinoic acid decreases expression ISO PSMA1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PSMA1 protein CTD PMID:17098229 Psma1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PSMA1 mRNA CTD PMID:30047161 Psma1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PSMA1 mRNA CTD PMID:16483693 Psma1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in decreased expression of PSMA1 mRNA CTD PMID:23912714 Psma1 Rat aristolochic acid A increases expression ISO PSMA1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PSMA1 protein CTD PMID:33212167 Psma1 Rat arsane multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA1 mRNA CTD PMID:39836092 Psma1 Rat arsenic atom multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA1 mRNA CTD PMID:39836092 Psma1 Rat arsenite(3-) multiple interactions ISO PSMA1 (Homo sapiens) 6480464 arsenite inhibits the reaction [TXNL1 protein binds to PSMA1 protein] and arsenite promotes the reaction [G3BP1 protein binds to PSMA1 mRNA] CTD PMID:19349280 and PMID:32406909 Psma1 Rat arsenous acid increases expression ISO PSMA1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMA1 mRNA CTD PMID:20458559 Psma1 Rat atrazine increases expression ISO Psma1 (Mus musculus) 6480464 Atrazine results in increased expression of PSMA1 mRNA CTD PMID:26518232 Psma1 Rat benzatropine decreases expression ISO PSMA1 (Homo sapiens) 6480464 Benztropine results in decreased expression of PSMA1 protein CTD PMID:34122009 Psma1 Rat benzo[a]pyrene increases expression ISO Psma1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PSMA1 mRNA CTD PMID:21715664 Psma1 Rat benzo[a]pyrene affects methylation ISO PSMA1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PSMA1 5' UTR CTD PMID:27901495 Psma1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of PSMA1 mRNA CTD PMID:21318169 Psma1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Psma1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PSMA1 mRNA CTD PMID:33754040 Psma1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PSMA1 mRNA CTD PMID:25181051 Psma1 Rat bisphenol A increases expression ISO PSMA1 (Homo sapiens) 6480464 bisphenol A results in increased expression of PSMA1 protein CTD PMID:37567409 Psma1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PSMA1 mRNA CTD PMID:36041667 Psma1 Rat bisphenol A decreases expression ISO PSMA1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PSMA1 mRNA and bisphenol A results in decreased expression of PSMA1 protein CTD PMID:29275510 and PMID:31675489 Psma1 Rat bisphenol AF increases expression ISO PSMA1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PSMA1 protein CTD PMID:34186270 Psma1 Rat Bisphenol B increases expression ISO PSMA1 (Homo sapiens) 6480464 bisphenol B results in increased expression of PSMA1 protein CTD PMID:34186270 Psma1 Rat bisphenol F multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PSMA1 mRNA CTD PMID:28628672 Psma1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PSMA1 mRNA CTD PMID:36041667 Psma1 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of PSMA1 mRNA CTD PMID:12628495 Psma1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PSMA1 mRNA CTD PMID:33453195 Psma1 Rat cisplatin increases phosphorylation ISO Psma1 (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of PSMA1 protein CTD PMID:22006019 Psma1 Rat cisplatin decreases expression ISO Psma1 (Mus musculus) 6480464 Cisplatin results in decreased expression of PSMA1 protein CTD PMID:29733421 Psma1 Rat cyclosporin A increases expression ISO PSMA1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PSMA1 mRNA CTD PMID:20106945 Psma1 Rat D-glucose decreases expression ISO PSMA1 (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of PSMA1 protein CTD PMID:22314686 Psma1 Rat deguelin increases expression ISO PSMA1 (Homo sapiens) 6480464 deguelin results in increased expression of PSMA1 mRNA CTD PMID:33512557 Psma1 Rat dexamethasone multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PSMA1 mRNA CTD PMID:28628672 Psma1 Rat diallyl trisulfide decreases expression ISO PSMA1 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of PSMA1 protein CTD PMID:19550292 Psma1 Rat diarsenic trioxide increases expression ISO PSMA1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PSMA1 mRNA CTD PMID:20458559 Psma1 Rat Dibutyl phosphate affects expression ISO PSMA1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PSMA1 mRNA CTD PMID:37042841 Psma1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMA1 mRNA CTD PMID:18636392 Psma1 Rat dicrotophos decreases expression ISO PSMA1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PSMA1 mRNA CTD PMID:28302478 Psma1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat disodium selenite increases expression ISO PSMA1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of PSMA1 mRNA CTD PMID:18175754 Psma1 Rat doxorubicin increases metabolic processing ISO PSMA1 (Homo sapiens) 6480464 Doxorubicin results in increased metabolism of PSMA1 protein CTD PMID:17346995 Psma1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PSMA1 mRNA CTD PMID:17920746 Psma1 Rat ethanol increases expression ISO Psma1 (Mus musculus) 6480464 Ethanol results in increased expression of PSMA1 mRNA CTD PMID:30319688 Psma1 Rat ethanol affects splicing ISO Psma1 (Mus musculus) 6480464 Ethanol affects the splicing of PSMA1 mRNA CTD PMID:30319688 Psma1 Rat fenpyroximate increases expression ISO PSMA1 (Homo sapiens) 6480464 fenpyroximate results in increased expression of PSMA1 mRNA CTD PMID:33512557 Psma1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PSMA1 mRNA CTD PMID:23962444 Psma1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PSMA1 mRNA CTD PMID:34044035 Psma1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PSMA1 mRNA CTD PMID:18035473 Psma1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat folic acid multiple interactions ISO Psma1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PSMA1 mRNA CTD PMID:22206623 Psma1 Rat folic acid increases expression ISO Psma1 (Mus musculus) 6480464 Folic Acid results in increased expression of PSMA1 mRNA CTD PMID:25629700 Psma1 Rat FR900359 increases phosphorylation ISO PSMA1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PSMA1 protein CTD PMID:37730182 Psma1 Rat furfural multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMA1 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of PSMA1 protein CTD PMID:38598786 Psma1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PSMA1 mRNA CTD PMID:22061828 Psma1 Rat glucose decreases expression ISO PSMA1 (Homo sapiens) 6480464 Glucose deficiency results in decreased expression of PSMA1 protein CTD PMID:22314686 Psma1 Rat indometacin multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PSMA1 mRNA CTD PMID:28628672 Psma1 Rat inulin multiple interactions ISO Psma1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PSMA1 mRNA CTD PMID:36331819 Psma1 Rat isotretinoin decreases expression ISO PSMA1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of PSMA1 mRNA CTD PMID:20436886 Psma1 Rat ivermectin decreases expression ISO PSMA1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PSMA1 protein CTD PMID:32959892 Psma1 Rat leflunomide increases expression EXP 6480464 leflunomide results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat Mesaconitine decreases expression EXP 6480464 mesaconitine results in decreased expression of PSMA1 protein CTD PMID:37182599 Psma1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of PSMA1 protein CTD PMID:19826936 Psma1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PSMA1 mRNA CTD PMID:30047161 Psma1 Rat microcystin RR increases expression ISO PSMA1 (Homo sapiens) 6480464 microcystin RR results in increased expression of PSMA1 protein CTD PMID:19111056 Psma1 Rat monocrotaline increases expression EXP 6480464 Monocrotaline results in increased expression of PSMA1 mRNA CTD PMID:18801959 Psma1 Rat monocrotaline multiple interactions EXP 6480464 Pentoxifylline inhibits the reaction [Monocrotaline results in increased expression of PSMA1 mRNA] CTD PMID:18801959 Psma1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO PSMA1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of PSMA1 mRNA CTD PMID:31806706 Psma1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of PSMA1 protein CTD PMID:19260726 Psma1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of PSMA1 mRNA CTD PMID:18636392 Psma1 Rat paracetamol affects expression ISO Psma1 (Mus musculus) 6480464 Acetaminophen affects the expression of PSMA1 mRNA CTD PMID:17562736 Psma1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PSMA1 mRNA and Acetaminophen results in increased expression of PSMA1 protein CTD PMID:15800402 Psma1 Rat pentachlorophenol increases expression ISO Psma1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PSMA1 mRNA CTD PMID:23892564 Psma1 Rat Pentoxifylline multiple interactions EXP 6480464 Pentoxifylline inhibits the reaction [Monocrotaline results in increased expression of PSMA1 mRNA] CTD PMID:18801959 Psma1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Psma1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of PSMA1 mRNA CTD PMID:19429403 Psma1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Psma1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PSMA1 mRNA more ... CTD PMID:20936131 and PMID:36331819 Psma1 Rat perfluorooctane-1-sulfonic acid increases expression ISO Psma1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of PSMA1 mRNA CTD PMID:20936131 Psma1 Rat perfluorooctanoic acid affects expression ISO Psma1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of PSMA1 mRNA CTD PMID:19429403 Psma1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PSMA1 mRNA CTD PMID:19162173 and PMID:21318169 Psma1 Rat perfluorooctanoic acid multiple interactions ISO Psma1 (Mus musculus) 6480464 PPARA protein affects the reaction [perfluorooctanoic acid results in increased expression of PSMA1 mRNA] CTD PMID:21318169 Psma1 Rat perfluorooctanoic acid increases expression ISO Psma1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of PSMA1 mRNA CTD PMID:21318169 Psma1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PSMA1 mRNA CTD PMID:19162173 Psma1 Rat picoxystrobin increases expression ISO PSMA1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of PSMA1 mRNA CTD PMID:33512557 Psma1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of PSMA1 mRNA CTD PMID:15890375 Psma1 Rat pirinixic acid decreases expression ISO Psma1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PSMA1 mRNA CTD PMID:18445702 Psma1 Rat pirinixic acid increases expression ISO Psma1 (Mus musculus) 6480464 pirinixic acid results in increased expression of PSMA1 mRNA CTD PMID:15375163 more ... Psma1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PSMA1 mRNA CTD PMID:15890375 more ... Psma1 Rat pirinixic acid multiple interactions ISO Psma1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of PSMA1 mRNA] CTD PMID:18467677 Psma1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PSMA1 mRNA CTD PMID:19162173 and PMID:21318169 Psma1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PSMA1 mRNA CTD PMID:30047161 Psma1 Rat ritonavir affects expression EXP 6480464 Ritonavir affects the expression of PSMA1 mRNA CTD PMID:17719200 Psma1 Rat rotenone decreases expression ISO Psma1 (Mus musculus) 6480464 Rotenone results in decreased expression of PSMA1 mRNA CTD PMID:23186747 Psma1 Rat sarin increases expression EXP 6480464 Sarin results in increased expression of PSMA1 protein CTD PMID:28973502 Psma1 Rat sirolimus decreases expression ISO Psma1 (Mus musculus) 6480464 Sirolimus results in decreased expression of PSMA1 mRNA CTD PMID:11355896 Psma1 Rat sodium arsenite increases expression ISO Psma1 (Mus musculus) 6480464 sodium arsenite results in increased expression of PSMA1 mRNA CTD PMID:28237703 Psma1 Rat sodium arsenite multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PSMA1 mRNA CTD PMID:39836092 Psma1 Rat sodium arsenite decreases expression ISO PSMA1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PSMA1 mRNA CTD PMID:38568856 Psma1 Rat sodium arsenite multiple interactions ISO Psma1 (Mus musculus) 6480464 NFE2L1 protein alternative form inhibits the reaction [sodium arsenite results in increased expression of PSMA1 mRNA] and UBC mRNA promotes the reaction [sodium arsenite results in increased expression of PSMA1 mRNA] CTD PMID:28237703 Psma1 Rat sodium chloride multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PSMA1 protein more ... CTD PMID:38598786 Psma1 Rat succimer multiple interactions ISO Psma1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of PSMA1 mRNA CTD PMID:21641980 Psma1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PSMA1 mRNA CTD PMID:30047161 Psma1 Rat tamoxifen increases expression ISO PSMA1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of PSMA1 protein CTD PMID:17098229 Psma1 Rat tamoxifen affects expression ISO Psma1 (Mus musculus) 6480464 Tamoxifen affects the expression of PSMA1 mRNA CTD PMID:17555576 Psma1 Rat tamoxifen multiple interactions ISO PSMA1 (Homo sapiens) 6480464 [Tretinoin co-treated with Tamoxifen] results in decreased expression of PSMA1 protein CTD PMID:17098229 Psma1 Rat tetrachloromethane increases expression ISO Psma1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PSMA1 mRNA CTD PMID:31919559 Psma1 Rat titanium dioxide decreases methylation ISO Psma1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PSMA1 gene and titanium dioxide results in decreased methylation of PSMA1 promoter CTD PMID:35295148 Psma1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PSMA1 mRNA CTD PMID:19448997 Psma1 Rat triphenyl phosphate affects expression ISO PSMA1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PSMA1 mRNA CTD PMID:37042841 Psma1 Rat tungsten increases expression ISO Psma1 (Mus musculus) 6480464 Tungsten results in increased expression of PSMA1 mRNA CTD PMID:30912803 Psma1 Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of PSMA1 mRNA CTD PMID:24136188 Psma1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of PSMA1 mRNA CTD PMID:21318169 Psma1 Rat valproic acid decreases methylation ISO PSMA1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PSMA1 gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (1->4)-beta-D-glucan (ISO) (Z)-3-butylidenephthalide (ISO) 1,2-dimethylhydrazine (ISO) 1-bromopropane (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrabromodibenzodioxine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-nitrofluorene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) bromobenzene (EXP) cadmium dichloride (EXP) cisplatin (ISO) cyclosporin A (ISO) D-glucose (ISO) deguelin (ISO) dexamethasone (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dichlorine (EXP) dicrotophos (ISO) diethylstilbestrol (EXP) disodium selenite (ISO) doxorubicin (ISO) ethanol (EXP,ISO) fenpyroximate (ISO) finasteride (EXP) fipronil (EXP) flavonoids (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) glucose (ISO) indometacin (ISO) inulin (ISO) isotretinoin (ISO) ivermectin (ISO) leflunomide (EXP) Mesaconitine (EXP) methamphetamine (EXP) methapyrilene (EXP) methimazole (EXP) microcystin RR (ISO) monocrotaline (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nimesulide (EXP) Nonylphenol (EXP) ozone (EXP) paracetamol (EXP,ISO) pentachlorophenol (ISO) Pentoxifylline (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP) picoxystrobin (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) ritonavir (EXP) rotenone (ISO) sarin (EXP) sirolimus (ISO) sodium arsenite (ISO) sodium chloride (ISO) succimer (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) tungsten (ISO) valdecoxib (EXP) valproic acid (EXP,ISO)
Cellular Component
centrosome (IEA,ISO) cytoplasm (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) proteasome complex (IEA,ISO) proteasome core complex (IEA,ISO,ISS) proteasome core complex, alpha-subunit complex (IBA,IEA,ISS)
Psma1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 177,876,838 - 177,887,857 (-) NCBI GRCr8 mRatBN7.2 1 168,442,421 - 168,453,440 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 168,440,936 - 168,453,472 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 176,771,846 - 176,782,862 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 183,957,918 - 183,968,934 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 176,671,909 - 176,682,943 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 183,733,567 - 183,744,586 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 183,733,567 - 183,744,586 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 190,708,745 - 190,719,764 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 172,237,763 - 172,248,782 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 172,373,871 - 172,384,891 (-) NCBI Celera 1 166,294,949 - 166,305,966 (-) NCBI Celera Cytogenetic Map 1 q34 NCBI
PSMA1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 14,504,876 - 14,643,662 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 14,504,211 - 14,643,635 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 14,526,422 - 14,665,208 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 14,482,998 - 14,621,739 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 14,482,998 - 14,621,739 NCBI Celera 11 14,651,494 - 14,790,271 (-) NCBI Celera Cytogenetic Map 11 p15.2 NCBI HuRef 11 14,207,557 - 14,313,706 (-) NCBI HuRef CHM1_1 11 14,525,354 - 14,664,092 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 14,600,152 - 14,738,957 (-) NCBI T2T-CHM13v2.0
Psma1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 113,863,785 - 113,875,351 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 113,863,841 - 113,875,353 (-) Ensembl GRCm39 Ensembl GRCm38 7 114,264,550 - 114,276,116 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 114,264,606 - 114,276,118 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 121,408,064 - 121,419,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 114,055,789 - 114,067,280 (-) NCBI MGSCv36 mm8 Celera 7 114,225,919 - 114,237,486 (-) NCBI Celera Cytogenetic Map 7 F1 NCBI cM Map 7 59.32 NCBI
Psma1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 29,665,335 - 29,679,922 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 29,667,417 - 29,679,510 (-) NCBI ChiLan1.0 ChiLan1.0
PSMA1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 16,886,092 - 17,024,783 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 16,846,932 - 16,985,649 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 14,607,557 - 14,746,207 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 14,298,860 - 14,314,780 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 14,298,860 - 14,314,780 (-) Ensembl panpan1.1 panPan2
LOC102152879 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 24,114,023 - 24,116,951 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 24,089,251 - 24,090,279 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 24,283,760 - 24,285,132 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 30 24,209,220 - 24,210,232 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 24,291,908 - 24,293,280 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 24,435,997 - 24,437,025 (+) NCBI UU_Cfam_GSD_1.0
Psma1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 48,161,083 - 48,173,283 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 4,195,072 - 4,209,558 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 4,195,072 - 4,207,263 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PSMA1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 44,648,247 - 44,757,440 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 44,740,102 - 44,755,296 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 47,966,027 - 47,981,201 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PSMA1
Psma1
.
Predicted Target Of
Count of predictions: 49 Count of miRNA genes: 41 Interacting mature miRNAs: 48 Transcripts: ENSRNOT00000015946 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 737974 Bp161 Blood pressure QTL 161 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 164747558 181133855 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 2312558 Glom17 Glomerulus QTL 17 3.9 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 166532971 191278129 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 1582204 Livw1 Liver weight QTL 1 3.6 0.0003 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 1 155422851 172949803 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 631548 Bp88 Blood pressure QTL 88 5 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 156677124 176484451 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
RH144128
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 168,441,156 - 168,441,301 (+) MAPPER mRatBN7.2 Rnor_6.0 1 183,732,303 - 183,732,447 NCBI Rnor6.0 Rnor_5.0 1 190,707,481 - 190,707,625 UniSTS Rnor5.0 RGSC_v3.4 1 172,236,499 - 172,236,643 UniSTS RGSC3.4 Celera 1 166,293,685 - 166,293,829 UniSTS RH 3.4 Map 1 1317.4 UniSTS Cytogenetic Map 1 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015946 ⟹ ENSRNOP00000015946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 168,440,936 - 168,453,472 (-) Ensembl Rnor_6.0 Ensembl 1 183,733,567 - 183,744,586 (-) Ensembl
RefSeq Acc Id:
NM_017278 ⟹ NP_058974
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 177,876,838 - 177,887,857 (-) NCBI mRatBN7.2 1 168,442,421 - 168,453,440 (-) NCBI Rnor_6.0 1 183,733,567 - 183,744,586 (-) NCBI Rnor_5.0 1 190,708,745 - 190,719,764 (-) NCBI RGSC_v3.4 1 172,237,763 - 172,248,782 (-) RGD Celera 1 166,294,949 - 166,305,966 (-) RGD
Sequence:
CCGCAGCCTTCTTTGACGATCACCGAACCGTAGTTGAGGCCGTGTTCCTGTGTCCGCTGCTGTGTCTGGTTGTAACCTCGCCGGAGCTATGTTTCGCAACCAGTATGACAACGATGTCACTGTTTGGA
hide sequence
RefSeq Acc Id:
NP_058974 ⟸ NM_017278
- UniProtKB:
P18420 (UniProtKB/Swiss-Prot), A6I899 (UniProtKB/TrEMBL), A6I8A1 (UniProtKB/TrEMBL)
- Sequence:
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPY
hide sequence
Ensembl Acc Id:
ENSRNOP00000015946 ⟸ ENSRNOT00000015946
RGD ID: 13690329 Promoter ID: EPDNEW_R854 Type: initiation region Name: Psma1_1 Description: proteasome subunit alpha 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 183,744,555 - 183,744,615 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-09-13
Psma1
proteasome 20S subunit alpha 1
Psma1
proteasome subunit alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-08-19
Psma1
proteasome subunit alpha 1
Psma1
proteasome (prosome, macropain) subunit, alpha type 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Psma1
proteasome (prosome, macropain) subunit, alpha type 1
Name updated
70584 APPROVED
