Symbol:
Rnase4
Name:
ribonuclease A family member 4
RGD ID:
61823
Description:
Predicted to enable RNA nuclease activity. Predicted to be involved in antibacterial humoral response and defense response to Gram-positive bacterium. Predicted to act upstream of or within cellular response to starvation. Predicted to be located in extracellular region. Predicted to be part of proton-transporting V-type ATPase, V1 domain. Predicted to be active in extracellular space. Orthologous to human RNASE4 (ribonuclease A family member 4); INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Rab1; ribonuclease 4; ribonuclease A b1; ribonuclease, RNase A family 4; RL3; RNase 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RNASE4 (ribonuclease A family member 4) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rnase4 (ribonuclease, RNase A family 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RNASE4 (ribonuclease A family member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RNASE4 (ribonuclease, RNase A family, 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rnase4 (ribonuclease A family member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RNASE4 (ribonuclease A family member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RNASE4 (ribonuclease A family member 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Rnase4 (ribonuclease, RNase A family 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RNASE4 (ribonuclease A family member 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rnasel2 (ribonuclease like 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
XB5802829 [provisional]
Alliance
DIOPT (PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,786,287 - 26,803,634 (+) NCBI GRCr8 mRatBN7.2 15 24,312,765 - 24,330,112 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,312,464 - 24,330,117 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 27,083,931 - 27,101,281 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 28,043,091 - 28,060,440 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,292,490 - 26,309,841 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 28,018,040 - 28,035,395 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 15 31,850,396 - 31,866,409 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 27,073,756 - 27,090,441 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 27,089,455 - 27,106,139 (+) NCBI Celera 15 24,631,848 - 24,647,995 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rnase4 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of RNASE4 mRNA] CTD PMID:31150632 Rnase4 Rat (1->4)-beta-D-glucan multiple interactions ISO Rnase4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RNASE4 mRNA CTD PMID:36331819 Rnase4 Rat 1,2-dimethylhydrazine decreases expression ISO Rnase4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of RNASE4 mRNA CTD PMID:22206623 Rnase4 Rat 1,2-dimethylhydrazine multiple interactions ISO Rnase4 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RNASE4 mRNA CTD PMID:22206623 Rnase4 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of RNASE4 mRNA CTD PMID:17108234 Rnase4 Rat 17beta-estradiol multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of RNASE4 mRNA CTD PMID:19619570 Rnase4 Rat 17beta-estradiol increases expression ISO Rnase4 (Mus musculus) 6480464 Estradiol results in increased expression of RNASE4 mRNA CTD PMID:19484750 and PMID:39298647 Rnase4 Rat 17beta-estradiol affects expression ISO RNASE4 (Homo sapiens) 6480464 Estradiol affects the expression of RNASE4 mRNA CTD PMID:14699072 and PMID:22574217 Rnase4 Rat 17beta-estradiol increases expression ISO RNASE4 (Homo sapiens) 6480464 Estradiol results in increased expression of RNASE4 mRNA CTD PMID:19619570 Rnase4 Rat 17beta-estradiol decreases expression ISO RNASE4 (Homo sapiens) 6480464 Estradiol results in decreased expression of RNASE4 mRNA CTD PMID:20106945 Rnase4 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RNASE4 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of RNASE4 mRNA CTD PMID:29581250 Rnase4 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RNASE4 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Rnase4 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Rnase4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of RNASE4 mRNA and [Tetrachlorodibenzodioxin co-treated with 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide] results in increased expression of RNASE4 mRNA CTD PMID:19619570 and PMID:29704546 Rnase4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rnase4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RNASE4 mRNA CTD PMID:21570461 and PMID:26377647 Rnase4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RNASE4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of RNASE4 mRNA CTD PMID:20106945 and PMID:21632981 Rnase4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RNASE4 mRNA CTD PMID:16054898 more ... Rnase4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RNASE4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of RNASE4 mRNA CTD PMID:19619570 Rnase4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Rnase4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Rnase4 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of RNASE4 mRNA CTD PMID:21346803 Rnase4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of RNASE4 mRNA CTD PMID:21346803 Rnase4 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:19692669 and PMID:23196670 Rnase4 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Rnase4 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Rnase4 Rat 4,4'-sulfonyldiphenol increases expression ISO Rnase4 (Mus musculus) 6480464 bisphenol S results in increased expression of RNASE4 mRNA CTD PMID:30951980 Rnase4 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rnase4 (Mus musculus) 6480464 bisphenol S results in decreased expression of RNASE4 mRNA CTD PMID:39298647 Rnase4 Rat 5-fluorouracil affects response to substance ISO RNASE4 (Homo sapiens) 6480464 RNASE4 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Rnase4 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RNASE4 mRNA CTD PMID:24780913 and PMID:30047161 Rnase4 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of RNASE4 mRNA CTD PMID:31881176 Rnase4 Rat aflatoxin B1 decreases expression ISO RNASE4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of RNASE4 mRNA CTD PMID:27153756 Rnase4 Rat aflatoxin B1 decreases methylation ISO RNASE4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of RNASE4 gene CTD PMID:27153756 Rnase4 Rat all-trans-retinoic acid increases expression ISO RNASE4 (Homo sapiens) 6480464 Tretinoin results in increased expression of RNASE4 mRNA CTD PMID:23830798 Rnase4 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RNASE4 mRNA CTD PMID:16483693 Rnase4 Rat amphotericin B decreases expression ISO RNASE4 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of RNASE4 mRNA CTD PMID:28534445 Rnase4 Rat Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of RNASE4 mRNA CTD PMID:18178546 Rnase4 Rat avobenzone increases expression ISO RNASE4 (Homo sapiens) 6480464 avobenzone results in increased expression of RNASE4 mRNA CTD PMID:31016361 Rnase4 Rat azathioprine decreases expression ISO RNASE4 (Homo sapiens) 6480464 Azathioprine results in decreased expression of RNASE4 mRNA CTD PMID:22623647 Rnase4 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat benzo[a]pyrene increases expression ISO Rnase4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RNASE4 mRNA CTD PMID:22228805 and PMID:29906497 Rnase4 Rat benzo[a]pyrene diol epoxide I affects expression ISO RNASE4 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Rnase4 Rat bilirubin IXalpha decreases expression ISO RNASE4 (Homo sapiens) 6480464 Bilirubin results in decreased expression of RNASE4 mRNA CTD PMID:20196124 Rnase4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rnase4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RNASE4 mRNA CTD PMID:34319233 Rnase4 Rat bisphenol A increases expression ISO Rnase4 (Mus musculus) 6480464 bisphenol A results in increased expression of RNASE4 mRNA CTD PMID:25594700 more ... Rnase4 Rat bisphenol A decreases expression ISO Rnase4 (Mus musculus) 6480464 bisphenol A results in decreased expression of RNASE4 protein CTD PMID:35999755 Rnase4 Rat bisphenol A affects expression ISO RNASE4 (Homo sapiens) 6480464 bisphenol A affects the expression of RNASE4 mRNA CTD PMID:30903817 Rnase4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of RNASE4 mRNA CTD PMID:30903817 Rnase4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RNASE4 mRNA CTD PMID:25181051 more ... Rnase4 Rat bisphenol F increases expression ISO Rnase4 (Mus musculus) 6480464 bisphenol F results in increased expression of RNASE4 mRNA CTD PMID:30951980 Rnase4 Rat butanal decreases expression ISO RNASE4 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of RNASE4 mRNA CTD PMID:26079696 Rnase4 Rat cadmium sulfate multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of RNASE4 mRNA CTD PMID:18654764 Rnase4 Rat carbon nanotube affects expression ISO Rnase4 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of RNASE4 mRNA CTD PMID:25620056 Rnase4 Rat carbon nanotube increases expression ISO Rnase4 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of RNASE4 mRNA CTD PMID:25620056 Rnase4 Rat carbon nanotube decreases expression ISO Rnase4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Rnase4 Rat carmustine increases expression ISO RNASE4 (Homo sapiens) 6480464 Carmustine results in increased expression of RNASE4 mRNA CTD PMID:15980968 Rnase4 Rat carnosic acid decreases expression ISO Rnase4 (Mus musculus) 6480464 salvin results in decreased expression of RNASE4 protein CTD PMID:35926579 Rnase4 Rat CGP 52608 multiple interactions ISO RNASE4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RNASE4 gene] CTD PMID:28238834 Rnase4 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of RNASE4 mRNA CTD PMID:20691718 Rnase4 Rat choline multiple interactions ISO Rnase4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of RNASE4 mRNA CTD PMID:20938992 Rnase4 Rat choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased expression of RNASE4 protein] CTD PMID:19566968 Rnase4 Rat ciglitazone multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of RNASE4 mRNA CTD PMID:16197558 Rnase4 Rat cisplatin multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RNASE4 mRNA CTD PMID:27392435 Rnase4 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat cobalt dichloride multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of RNASE4 mRNA CTD PMID:18654764 Rnase4 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of RNASE4 mRNA CTD PMID:24386269 Rnase4 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of RNASE4 mRNA CTD PMID:30556269 Rnase4 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of RNASE4 mRNA CTD PMID:30556269 Rnase4 Rat copper(II) sulfate decreases expression ISO RNASE4 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RNASE4 mRNA CTD PMID:19549813 Rnase4 Rat crocidolite asbestos decreases expression ISO RNASE4 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of RNASE4 mRNA CTD PMID:18687144 Rnase4 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of RNASE4 mRNA CTD PMID:26577399 Rnase4 Rat cyclosporin A decreases expression ISO Rnase4 (Mus musculus) 6480464 Cyclosporine results in decreased expression of RNASE4 mRNA CTD PMID:19770486 Rnase4 Rat cyclosporin A decreases expression ISO RNASE4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RNASE4 mRNA CTD PMID:25562108 Rnase4 Rat cyclosporin A increases expression ISO RNASE4 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RNASE4 mRNA CTD PMID:20106945 more ... Rnase4 Rat dicrotophos decreases expression ISO RNASE4 (Homo sapiens) 6480464 dicrotophos results in decreased expression of RNASE4 mRNA CTD PMID:28302478 Rnase4 Rat dimethyl sulfoxide affects expression ISO RNASE4 (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of RNASE4 mRNA CTD PMID:24834073 Rnase4 Rat dioxygen multiple interactions ISO Rnase4 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of RNASE4 mRNA CTD PMID:30529165 Rnase4 Rat diquat increases expression ISO Rnase4 (Mus musculus) 6480464 Diquat results in increased expression of RNASE4 protein CTD PMID:36851058 Rnase4 Rat diuron decreases expression ISO RNASE4 (Homo sapiens) 6480464 Diuron results in decreased expression of RNASE4 mRNA CTD PMID:35967413 Rnase4 Rat dorsomorphin multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of RNASE4 mRNA CTD PMID:29391264 Rnase4 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of RNASE4 mRNA CTD PMID:15353170 Rnase4 Rat ethanol increases expression ISO Rnase4 (Mus musculus) 6480464 Ethanol results in increased expression of RNASE4 mRNA CTD PMID:30319688 Rnase4 Rat ethyl methanesulfonate increases expression ISO RNASE4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of RNASE4 mRNA CTD PMID:23649840 Rnase4 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of RNASE4 mRNA CTD PMID:24793618 Rnase4 Rat folic acid multiple interactions ISO Rnase4 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Rnase4 Rat folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased expression of RNASE4 protein] CTD PMID:19566968 Rnase4 Rat folic acid increases expression EXP 6480464 Folic Acid deficiency results in increased expression of RNASE4 protein CTD PMID:19566968 Rnase4 Rat furan decreases expression EXP 6480464 furan results in decreased expression of RNASE4 mRNA CTD PMID:25539665 Rnase4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of RNASE4 mRNA CTD PMID:33387578 Rnase4 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of RNASE4 mRNA CTD PMID:24136188 Rnase4 Rat GW 4064 increases expression ISO Rnase4 (Mus musculus) 6480464 GW 4064 results in increased expression of RNASE4 mRNA CTD PMID:26655953 Rnase4 Rat hydroquinone decreases expression ISO RNASE4 (Homo sapiens) 6480464 hydroquinone results in decreased expression of RNASE4 mRNA CTD PMID:31256213 Rnase4 Rat inulin multiple interactions ISO Rnase4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of RNASE4 mRNA CTD PMID:36331819 Rnase4 Rat iron atom increases expression ISO RNASE4 (Homo sapiens) 6480464 Iron deficiency results in increased expression of RNASE4 mRNA CTD PMID:20368581 Rnase4 Rat iron(0) increases expression ISO RNASE4 (Homo sapiens) 6480464 Iron deficiency results in increased expression of RNASE4 mRNA CTD PMID:20368581 Rnase4 Rat isoprenaline increases expression ISO Rnase4 (Mus musculus) 6480464 Isoproterenol results in increased expression of RNASE4 mRNA CTD PMID:20003209 Rnase4 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of RNASE4 mRNA CTD PMID:20080153 Rnase4 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of RNASE4 mRNA CTD PMID:36653537 Rnase4 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat L-methionine multiple interactions ISO Rnase4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of RNASE4 mRNA CTD PMID:20938992 Rnase4 Rat L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency] inhibits the reaction [Folic Acid deficiency results in increased expression of RNASE4 protein] CTD PMID:19566968 Rnase4 Rat lead diacetate increases expression ISO Rnase4 (Mus musculus) 6480464 lead acetate results in increased expression of RNASE4 mRNA CTD PMID:21829687 Rnase4 Rat lead(II) chloride increases expression ISO RNASE4 (Homo sapiens) 6480464 lead chloride results in increased expression of RNASE4 mRNA CTD PMID:18654764 Rnase4 Rat lead(II) chloride multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of RNASE4 mRNA CTD PMID:18654764 Rnase4 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of RNASE4 mRNA CTD PMID:30467583 Rnase4 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RNASE4 mRNA CTD PMID:30047161 Rnase4 Rat methylmercury chloride decreases expression ISO RNASE4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RNASE4 mRNA CTD PMID:28801915 Rnase4 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of RNASE4 mRNA CTD PMID:19638242 Rnase4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of RNASE4 mRNA CTD PMID:28943392 Rnase4 Rat N-nitrosodiethylamine decreases expression ISO Rnase4 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of RNASE4 mRNA CTD PMID:24535843 Rnase4 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of RNASE4 mRNA CTD PMID:17072980 Rnase4 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of RNASE4 mRNA CTD PMID:24136188 Rnase4 Rat nickel atom decreases expression ISO RNASE4 (Homo sapiens) 6480464 Nickel results in decreased expression of RNASE4 mRNA CTD PMID:24768652 and PMID:25583101 Rnase4 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of RNASE4 mRNA CTD PMID:24136188 Rnase4 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat ozone multiple interactions ISO Rnase4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of RNASE4 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of RNASE4 mRNA CTD PMID:34911549 Rnase4 Rat paracetamol affects expression ISO Rnase4 (Mus musculus) 6480464 Acetaminophen affects the expression of RNASE4 mRNA CTD PMID:17562736 Rnase4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RNASE4 mRNA CTD PMID:33387578 Rnase4 Rat paracetamol decreases expression ISO RNASE4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RNASE4 mRNA CTD PMID:21420995 Rnase4 Rat pentanal decreases expression ISO RNASE4 (Homo sapiens) 6480464 pentanal results in decreased expression of RNASE4 mRNA CTD PMID:26079696 Rnase4 Rat perfluorohexanesulfonic acid increases expression ISO Rnase4 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of RNASE4 mRNA CTD PMID:37995155 Rnase4 Rat perfluorononanoic acid decreases expression ISO RNASE4 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of RNASE4 mRNA CTD PMID:32588087 Rnase4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Rnase4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of RNASE4 mRNA more ... CTD PMID:36331819 Rnase4 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of RNASE4 mRNA CTD PMID:19162173 Rnase4 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of RNASE4 mRNA CTD PMID:19162173 Rnase4 Rat phenobarbital affects expression ISO Rnase4 (Mus musculus) 6480464 Phenobarbital affects the expression of RNASE4 mRNA CTD PMID:23091169 Rnase4 Rat phenobarbital affects expression ISO RNASE4 (Homo sapiens) 6480464 Phenobarbital affects the expression of RNASE4 mRNA CTD PMID:19159669 Rnase4 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of RNASE4 mRNA CTD PMID:22484513 Rnase4 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat pirinixic acid decreases expression ISO Rnase4 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RNASE4 mRNA CTD PMID:23811191 Rnase4 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of RNASE4 mRNA CTD PMID:19162173 Rnase4 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of RNASE4 mRNA CTD PMID:30047161 Rnase4 Rat progesterone increases expression ISO RNASE4 (Homo sapiens) 6480464 Progesterone results in increased expression of RNASE4 mRNA CTD PMID:21795739 Rnase4 Rat propanal decreases expression ISO RNASE4 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of RNASE4 mRNA CTD PMID:26079696 Rnase4 Rat quercetin decreases expression ISO RNASE4 (Homo sapiens) 6480464 Quercetin results in decreased expression of RNASE4 mRNA CTD PMID:21632981 Rnase4 Rat SB 431542 multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat silicon dioxide decreases expression ISO RNASE4 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of RNASE4 mRNA and Silicon Dioxide results in decreased expression of RNASE4 mRNA CTD PMID:25895662 and PMID:28425640 Rnase4 Rat sodium arsenite decreases expression ISO Rnase4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of RNASE4 mRNA CTD PMID:37682722 Rnase4 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of RNASE4 mRNA CTD PMID:25993096 Rnase4 Rat succimer multiple interactions ISO Rnase4 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of RNASE4 mRNA CTD PMID:21641980 Rnase4 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of RNASE4 mRNA CTD PMID:30047161 Rnase4 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of RNASE4 mRNA CTD PMID:21515302 Rnase4 Rat tetrachloromethane affects expression ISO Rnase4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of RNASE4 mRNA CTD PMID:17484886 Rnase4 Rat tetrachloromethane decreases expression ISO Rnase4 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of RNASE4 mRNA CTD PMID:31919559 Rnase4 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of RNASE4 mRNA] CTD PMID:31150632 Rnase4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of RNASE4 mRNA CTD PMID:31150632 Rnase4 Rat thapsigargin decreases expression ISO Rnase4 (Mus musculus) 6480464 Thapsigargin results in decreased expression of RNASE4 protein CTD PMID:24648495 Rnase4 Rat thimerosal decreases expression ISO RNASE4 (Homo sapiens) 6480464 Thimerosal results in decreased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of RNASE4 mRNA CTD PMID:19483382 Rnase4 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in decreased expression of RNASE4 mRNA CTD PMID:28943392 Rnase4 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of RNASE4 mRNA CTD PMID:23411599 and PMID:34492290 Rnase4 Rat titanium dioxide affects expression ISO Rnase4 (Mus musculus) 6480464 titanium dioxide affects the expression of RNASE4 mRNA CTD PMID:23557971 Rnase4 Rat trichloroethene increases expression ISO Rnase4 (Mus musculus) 6480464 Trichloroethylene results in increased expression of RNASE4 mRNA CTD PMID:28973375 Rnase4 Rat trichostatin A increases expression ISO RNASE4 (Homo sapiens) 6480464 trichostatin A results in increased expression of RNASE4 mRNA CTD PMID:24935251 Rnase4 Rat triclosan increases expression ISO RNASE4 (Homo sapiens) 6480464 Triclosan results in increased expression of RNASE4 mRNA CTD PMID:30510588 Rnase4 Rat troglitazone increases expression ISO Rnase4 (Mus musculus) 6480464 troglitazone results in increased expression of RNASE4 mRNA CTD PMID:28973697 Rnase4 Rat troglitazone decreases expression ISO RNASE4 (Homo sapiens) 6480464 troglitazone results in decreased expression of RNASE4 mRNA CTD PMID:25572481 Rnase4 Rat tunicamycin increases expression ISO RNASE4 (Homo sapiens) 6480464 Tunicamycin results in increased expression of RNASE4 mRNA CTD PMID:38498338 Rnase4 Rat urethane decreases expression ISO RNASE4 (Homo sapiens) 6480464 Urethane results in decreased expression of RNASE4 mRNA CTD PMID:28818685 Rnase4 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of RNASE4 mRNA CTD PMID:24136188 Rnase4 Rat valproic acid decreases expression ISO RNASE4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RNASE4 mRNA CTD PMID:29154799 Rnase4 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of RNASE4 mRNA CTD PMID:29427782 Rnase4 Rat valproic acid increases expression ISO RNASE4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of RNASE4 mRNA CTD PMID:23179753 more ... Rnase4 Rat valproic acid multiple interactions ISO RNASE4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat valproic acid affects expression ISO RNASE4 (Homo sapiens) 6480464 Valproic Acid affects the expression of RNASE4 mRNA CTD PMID:25979313 Rnase4 Rat valproic acid decreases methylation ISO RNASE4 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of RNASE4 gene CTD PMID:29154799 Rnase4 Rat valproic acid increases expression ISO Rnase4 (Mus musculus) 6480464 Valproic Acid results in increased expression of RNASE4 mRNA CTD PMID:19136453 and PMID:21427059 Rnase4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of RNASE4 mRNA CTD PMID:19015723 Rnase4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of RNASE4 mRNA CTD PMID:23869203 Rnase4 Rat vorinostat increases expression ISO RNASE4 (Homo sapiens) 6480464 vorinostat results in increased expression of RNASE4 mRNA CTD PMID:27188386 Rnase4 Rat zinc atom decreases expression ISO RNASE4 (Homo sapiens) 6480464 Zinc results in decreased expression of RNASE4 mRNA CTD PMID:15984569 Rnase4 Rat zinc(0) decreases expression ISO RNASE4 (Homo sapiens) 6480464 Zinc results in decreased expression of RNASE4 mRNA CTD PMID:15984569
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) ammonium chloride (EXP) amphotericin B (ISO) Aroclor 1254 (EXP) avobenzone (ISO) azathioprine (ISO) benzbromarone (EXP) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium sulfate (ISO) carbon nanotube (ISO) carmustine (ISO) carnosic acid (ISO) CGP 52608 (ISO) chlorpyrifos (EXP) choline (EXP,ISO) ciglitazone (ISO) cisplatin (ISO) clofibrate (EXP) cobalt dichloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) dicrotophos (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) diquat (ISO) diuron (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) flutamide (EXP) folic acid (EXP,ISO) furan (EXP) gentamycin (EXP) glafenine (EXP) GW 4064 (ISO) hydroquinone (ISO) inulin (ISO) iron atom (ISO) iron(0) (ISO) isoprenaline (ISO) ketamine (EXP) ketoconazole (EXP) L-ethionine (EXP) L-methionine (EXP,ISO) lead diacetate (ISO) lead(II) chloride (ISO) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) omeprazole (EXP) ozone (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (EXP,ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propanal (ISO) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) succimer (ISO) sulfadimethoxine (EXP) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (ISO) triclosan (ISO) troglitazone (ISO) tunicamycin (ISO) urethane (ISO) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (EXP) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.
GOA pipeline
RGD automated data pipeline
5.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
7.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
8.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.
Ribonucleases from rat and bovine liver: purification, specificity and structural characterization.
Zhao W, etal., Biochim Biophys Acta 1998 Apr 23;1384(1):55-65.
Rnase4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 26,786,287 - 26,803,634 (+) NCBI GRCr8 mRatBN7.2 15 24,312,765 - 24,330,112 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 24,312,464 - 24,330,117 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 27,083,931 - 27,101,281 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 28,043,091 - 28,060,440 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 26,292,490 - 26,309,841 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 28,018,040 - 28,035,395 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 15 31,850,396 - 31,866,409 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 27,073,756 - 27,090,441 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 27,089,455 - 27,106,139 (+) NCBI Celera 15 24,631,848 - 24,647,995 (+) NCBI Celera Cytogenetic Map 15 p14 NCBI
RNASE4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 20,684,560 - 20,701,216 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 20,684,560 - 20,701,216 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 21,152,719 - 21,169,375 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 20,222,212 - 20,238,598 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 20,226,771 - 20,238,597 NCBI Celera 14 1,013,244 - 1,029,632 (+) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 1,273,295 - 1,289,678 (+) NCBI HuRef CHM1_1 14 21,154,392 - 21,170,774 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 14,881,670 - 14,898,327 (+) NCBI T2T-CHM13v2.0
Rnase4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 51,328,534 - 51,343,608 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 51,328,534 - 51,343,608 (+) Ensembl GRCm39 Ensembl GRCm38 14 51,091,077 - 51,106,151 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 51,091,077 - 51,106,151 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 51,710,752 - 51,725,826 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 50,013,147 - 50,028,091 (+) NCBI MGSCv36 mm8 MGSCv36 14 42,955,672 - 42,970,033 (+) NCBI MGSCv36 mm8 Celera 14 47,385,172 - 47,400,997 (+) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 26.37 NCBI
RNASE4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 22,182,660 - 22,200,165 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 21,397,673 - 21,416,652 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 1,548,729 - 1,564,819 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 19,605,890 - 19,621,987 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 19,620,758 - 19,621,201 (+) Ensembl panpan1.1 panPan2
RNASE4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 17,981,661 - 17,998,644 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 17,981,647 - 18,004,631 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 18,467,471 - 18,484,458 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 18,242,716 - 18,259,707 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 18,242,716 - 18,260,248 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 17,924,113 - 17,941,085 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 17,980,204 - 17,997,189 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 18,107,982 - 18,124,962 (+) NCBI UU_Cfam_GSD_1.0
Rnase4
RNASE4
RNASE4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 21,216,021 - 21,233,306 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 21,216,477 - 21,232,699 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 25,197,478 - 25,214,890 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 84 Count of miRNA genes: 67 Interacting mature miRNAs: 77 Transcripts: ENSRNOT00000041495 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat
RH127443
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 24,329,729 - 24,329,913 (+) MAPPER mRatBN7.2 Rnor_6.0 15 28,035,009 - 28,035,192 NCBI Rnor6.0 Rnor_5.0 15 31,866,023 - 31,866,206 UniSTS Rnor5.0 RGSC_v3.4 15 27,090,059 - 27,090,242 UniSTS RGSC3.4 Celera 15 24,647,613 - 24,647,796 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
18
22
87
175
179
177
118
47
118
12
418
180
135
86
111
59
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041495 ⟹ ENSRNOP00000043003
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,312,464 - 24,330,117 (+) Ensembl Rnor_6.0 Ensembl 15 28,018,040 - 28,035,389 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089631 ⟹ ENSRNOP00000073131
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 24,312,557 - 24,330,117 (+) Ensembl Rnor_6.0 Ensembl 15 28,028,521 - 28,035,389 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090272 ⟹ ENSRNOP00000069341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 28,023,018 - 28,034,590 (+) Ensembl
RefSeq Acc Id:
NM_020082 ⟹ NP_064467
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,786,287 - 26,803,634 (+) NCBI mRatBN7.2 15 24,312,765 - 24,330,112 (+) NCBI Rnor_6.0 15 28,018,040 - 28,035,391 (+) NCBI Rnor_5.0 15 31,850,396 - 31,866,409 (+) NCBI RGSC_v3.4 15 27,073,756 - 27,090,441 (+) RGD Celera 15 24,631,848 - 24,647,995 (+) RGD
Sequence:
GGAAAAAGGAGTGAGAAACAAAGCCGTCATCTCCAGTTCCGCGTCCAGGCACTTTCTAGGTGACGATGGACATACAGAGGACCCAATCCTTGCTTCTGCTCTTGTTGCTGACCCTGCTGGGGTTAGGG
hide sequence
RefSeq Acc Id:
XM_063274591 ⟹ XP_063130661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,790,215 - 26,803,634 (+) NCBI
RefSeq Acc Id:
XM_063274592 ⟹ XP_063130662
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 26,796,265 - 26,803,634 (+) NCBI
RefSeq Acc Id:
NP_064467 ⟸ NM_020082
- Peptide Label:
precursor
- UniProtKB:
O55004 (UniProtKB/Swiss-Prot), W0UVG1 (UniProtKB/TrEMBL)
- Sequence:
MDIQRTQSLLLLLLLTLLGLGLVQPSYGQDRMYQRFLRQHVDPEGTGGSDNYCNVMMQRRRMTSTQCKRFNTFIHEDIWNIRSICDTANIPCKNGNMNCHEGIVRVTDCRETGSSVPHNCRYRARAST
hide sequence
Ensembl Acc Id:
ENSRNOP00000073131 ⟸ ENSRNOT00000089631
Ensembl Acc Id:
ENSRNOP00000069341 ⟸ ENSRNOT00000090272
Ensembl Acc Id:
ENSRNOP00000043003 ⟸ ENSRNOT00000041495
RefSeq Acc Id:
XP_063130661 ⟸ XM_063274591
- Peptide Label:
isoform X1
- UniProtKB:
O55004 (UniProtKB/Swiss-Prot), W0UVG1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130662 ⟸ XM_063274592
- Peptide Label:
isoform X1
- UniProtKB:
O55004 (UniProtKB/Swiss-Prot), W0UVG1 (UniProtKB/TrEMBL)
RGD ID: 13699629 Promoter ID: EPDNEW_R10151 Type: initiation region Name: Rnase4_1 Description: ribonuclease A family member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10152 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 28,017,985 - 28,018,045 EPDNEW
RGD ID: 13699642 Promoter ID: EPDNEW_R10152 Type: multiple initiation site Name: Rnase4_2 Description: ribonuclease A family member 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10151 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 28,022,993 - 28,023,053 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Rnase4
ribonuclease A family member 4
Rnase4
ribonuclease, RNase A family 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Rnase4
ribonuclease, RNase A family 4
Name updated
70584 APPROVED
2001-07-23
Rnase4
ibonuclease, RNase A family 4
Name withdrawn
67952 WITHDRAWN
2001-07-23
Rnase4
ribonuclease, RNase A family 4
Name withdrawn
67952 APPROVED
Note Type
Note
Reference
gene_expression
expressed in liver
61732
