Advanced Search (OLGA)

Gene: Npvf (neuropeptide VF precursor) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Npvf

Name:

neuropeptide VF precursor

RGD ID:

61815

Description:

Enables signaling receptor binding activity. Involved in neuropeptide signaling pathway. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Orthologous to human NPVF (neuropeptide VF precursor); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FMRFamide-related peptides; pro-FMRFamide-related neuropeptide VF; RFamide related peptide; RFamide-related peptide; Rfrp

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NPVF (neuropeptide VF precursor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Npvf (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Npvf (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NPVF (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NPVF (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Npvf (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NPVF (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NPVF (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Npvf (neuropeptide VF precursor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	C16orf86 (chromosome 16 open reading frame 86)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Npvf (neuropeptide VF precursor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NPVF (neuropeptide VF precursor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	npvf (neuropeptide VF precursor)	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	81,043,128 - 81,047,045 (-)	NCBI		GRCr8
mRatBN7.2	4	79,712,358 - 79,716,275 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	79,712,520 - 79,716,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	84,929,993 - 84,933,709 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	80,705,514 - 80,709,230 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	79,145,852 - 79,149,568 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	80,391,785 - 80,395,476 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	80,391,785 - 80,395,502 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	145,061,114 - 145,064,805 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	78,886,521 - 78,890,237 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	79,162,650 - 79,166,367 (-)	NCBI
Celera	4	74,619,146 - 74,622,862 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npvf	Rat	pleomorphic xanthoastrocytoma		ISO	NPVF (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npvf	Rat	1,2-dichloroethane	increases expression	ISO	Npvf (Mus musculus)	6480464	ethylene dichloride results in increased expression of NPVF mRNA	CTD	PMID:28960355
Npvf	Rat	1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile	affects expression	ISO	Npvf (Mus musculus)	6480464	Citalopram affects the expression of NPVF mRNA	CTD	PMID:20381503
Npvf	Rat	17beta-estradiol	multiple interactions	EXP		6480464	NPVF protein inhibits the reaction [Estradiol results in increased expression of FOS protein]	CTD	PMID:19022888
Npvf	Rat	17beta-estradiol	decreases expression	ISO	Npvf (Mus musculus)	6480464	Estradiol results in decreased expression of NPVF mRNA	CTD	PMID:19484750
Npvf	Rat	17beta-estradiol	decreases response to substance	EXP		6480464	NPVF protein results in decreased susceptibility to Estradiol	CTD	PMID:19022888
Npvf	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NPVF mRNA	CTD	PMID:32109520
Npvf	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Npvf (Mus musculus)	6480464	bisphenol S results in increased expression of NPVF mRNA	CTD	PMID:30951980
Npvf	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of NPVF mRNA	CTD	PMID:16483693
Npvf	Rat	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of NPVF mRNA	CTD	PMID:21839799
Npvf	Rat	benzo[a]pyrene	decreases expression	ISO	NPVF (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of NPVF mRNA	CTD	PMID:22316170
Npvf	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NPVF mRNA	CTD	PMID:25181051
Npvf	Rat	bisphenol F	increases expression	ISO	Npvf (Mus musculus)	6480464	bisphenol F results in increased expression of NPVF mRNA	CTD	PMID:30951980
Npvf	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of NPVF mRNA	CTD	PMID:19167457
Npvf	Rat	citalopram	affects expression	ISO	Npvf (Mus musculus)	6480464	Citalopram affects the expression of NPVF mRNA	CTD	PMID:20381503
Npvf	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of NPVF mRNA	CTD	PMID:26033743
Npvf	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of NPVF mRNA	CTD	PMID:26033743
Npvf	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of NPVF mRNA	CTD	PMID:27523638
Npvf	Rat	endosulfan	increases expression	ISO	NPVF (Homo sapiens)	6480464	Endosulfan results in increased expression of NPVF mRNA	CTD	PMID:28108160
Npvf	Rat	epoxiconazole	increases expression	ISO	Npvf (Mus musculus)	6480464	epoxiconazole results in increased expression of NPVF mRNA	CTD	PMID:35436446
Npvf	Rat	furan	decreases expression	EXP		6480464	furan results in decreased expression of NPVF mRNA	CTD	PMID:25539665
Npvf	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of NPVF mRNA	CTD	PMID:22061828
Npvf	Rat	sodium arsenite	increases expression	ISO	NPVF (Homo sapiens)	6480464	sodium arsenite results in increased expression of NPVF mRNA	CTD	PMID:29301061
Npvf	Rat	titanium dioxide	decreases expression	ISO	Npvf (Mus musculus)	6480464	titanium dioxide results in decreased expression of NPVF mRNA	CTD	PMID:29264374
Npvf	Rat	valproic acid	affects expression	ISO	Npvf (Mus musculus)	6480464	Valproic Acid affects the expression of NPVF mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npvf	Rat	negative regulation of gonadotropin secretion	involved_in	IEA	UniProtKB:Q9HCQ7 and ensembl:ENSP00000222674	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npvf	Rat	negative regulation of gonadotropin secretion	involved_in	IBA	PANTHER:PTN002683400 and UniProtKB:Q9HCQ7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Npvf	Rat	negative regulation of gonadotropin secretion	involved_in	ISO	NPVF (Homo sapiens)	1624291	PMID:20027225	RGD	PMID:20027225
Npvf	Rat	neuropeptide signaling pathway		IMP		628488		RGD
Npvf	Rat	neuropeptide signaling pathway	involved_in	IEA	InterPro:IPR026297	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Npvf	Rat	neuropeptide signaling pathway	involved_in	IBA	PANTHER:PTN002683400 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Npvf	Rat	neuropeptide signaling pathway	involved_in	ISO	NPVF (Homo sapiens)	1624291	PMID:11025660	RGD	PMID:11025660
Npvf	Rat	neuropeptide signaling pathway	involved_in	IEA	UniProtKB:Q9HCQ7 and ensembl:ENSP00000222674	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npvf	Rat	neuropeptide signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0527	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npvf	Rat	neuropeptide signaling pathway	involved_in	ISO	NPVF (Homo sapiens) more ...	1624291	PMID:18752651	RGD	PMID:18752651

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npvf	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Npvf	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Npvf	Rat	extracellular space	is_active_in	ISO	NPVF (Homo sapiens)	1624291	PMID:11025660	RGD	PMID:11025660
Npvf	Rat	extracellular space	is_active_in	IEA	UniProtKB:Q9HCQ7 and ensembl:ENSP00000222674	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Npvf	Rat	neuropeptide activity	NOT\|enables	ISO	NPVF (Homo sapiens) and UniProtKB:Q9HCQ7-PRO_0000009923	1624291	PMID:18752651	RGD	PMID:18752651
Npvf	Rat	neuropeptide activity	enables	ISO	NPVF (Homo sapiens)	1624291	PMID:11025660	RGD	PMID:11025660
Npvf	Rat	neuropeptide activity	enables	IEA	UniProtKB:Q9HCQ7 and ensembl:ENSP00000222674	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Npvf	Rat	neuropeptide activity	enables	ISO	NPVF (Homo sapiens) more ...	1624291	PMID:18752651	RGD	PMID:18752651
Npvf	Rat	protein binding	enables	ISO	NPVF (Homo sapiens)	1624291	UniProtKB:O43765 more ...	RGD	PMID:32296183
Npvf	Rat	signaling receptor binding		IDA		628488		RGD
Npvf	Rat	signaling receptor binding	enables	IBA	PANTHER:PTN002683400 and Npvf (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals.	Hinuma S, etal., Nat Cell Biol 2000 Oct;2(10):703-8.
3.	Identification and characterization of novel mammalian neuropeptide FF-like peptides that attenuate morphine-induced antinociception.	Liu Q, etal., J Biol Chem 2001 Oct 5;276(40):36961-9.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11852091	PMID:17113584	PMID:18628614	PMID:19008316	PMID:19101033	PMID:19541621	PMID:20027225	PMID:20136694	PMID:20424142	PMID:22064075	PMID:24412804	PMID:24823392
PMID:25581095	PMID:29913425	PMID:30307156	PMID:32328034	PMID:34655735

Npvf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	81,043,128 - 81,047,045 (-)	NCBI		GRCr8
mRatBN7.2	4	79,712,358 - 79,716,275 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	79,712,520 - 79,716,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	84,929,993 - 84,933,709 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	80,705,514 - 80,709,230 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	79,145,852 - 79,149,568 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	80,391,785 - 80,395,476 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	80,391,785 - 80,395,502 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	145,061,114 - 145,064,805 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	78,886,521 - 78,890,237 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	79,162,650 - 79,166,367 (-)	NCBI
Celera	4	74,619,146 - 74,622,862 (-)	NCBI		Celera
Cytogenetic Map	4	q24	NCBI

NPVF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	25,224,570 - 25,228,486 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	25,224,570 - 25,228,486 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	25,264,189 - 25,268,105 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	25,230,714 - 25,234,630 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	25,037,432 - 25,041,345	NCBI
Celera	7	25,253,342 - 25,257,259 (-)	NCBI		Celera
Cytogenetic Map	7	p15.3	NCBI
HuRef	7	25,150,784 - 25,154,701 (-)	NCBI		HuRef
CHM1_1	7	25,266,169 - 25,270,086 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	25,360,013 - 25,363,930 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	25,315,484 - 25,319,401 (-)	NCBI

Npvf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	50,627,652 - 50,631,425 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	50,627,652 - 50,631,419 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	50,650,672 - 50,654,445 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	50,650,672 - 50,654,439 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	50,600,870 - 50,604,392 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	50,580,457 - 50,583,979 (-)	NCBI		MGSCv36	mm8
Celera	6	51,168,462 - 51,171,984 (-)	NCBI		Celera
Cytogenetic Map	6	B2.3	NCBI
cM Map	6	24.34	NCBI

Npvf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955410	27,161,730 - 27,165,341 (-)	NCBI	ChiLan1.0	ChiLan1.0

NPVF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	30,067,706 - 30,071,629 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	78,392,433 - 78,396,356 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	25,883,679 - 25,887,596 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	25,489,577 - 25,493,126 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	25,489,577 - 25,493,126 (-)	Ensembl	panpan1.1		panPan2

NPVF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	38,652,870 - 38,656,241 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	38,652,870 - 38,656,241 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	38,202,380 - 38,205,751 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	38,591,233 - 38,594,603 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	38,591,233 - 38,594,603 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	38,701,648 - 38,705,017 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	38,394,782 - 38,398,153 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	38,738,901 - 38,742,321 (-)	NCBI		UU_Cfam_GSD_1.0

Npvf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	82,895,882 - 82,899,554 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	2,107,835 - 2,111,188 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	2,107,835 - 2,111,188 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NPVF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	47,082,963 - 47,087,357 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	47,082,678 - 47,087,651 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	51,890,546 - 51,895,218 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NPVF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	33,118,553 - 33,123,057 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666042	71,531,249 - 71,539,948 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Npvf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624739	5,321,132 - 5,325,519 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624739	5,321,831 - 5,323,710 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Npvf
21 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	11
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000014437
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	57486946	102486946	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
2317586	Eae25	Experimental allergic encephalomyelitis QTL 25	9.300000190734863		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	4	78882817	83007655	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78885890	102684881	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
634311	Sach7	Saccharin preference QTL 7			taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	57114432	81266970	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	65882107	96130297	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	62933508	82490359	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1558651	Swd3	Spike wave discharge measurement QTL 3	4.62	0.000024	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	4	58432133	92991462	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
631546	Bp86	Blood pressure QTL 86	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	57114432	91360801	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
7394826	Bw126	Body weight QTL 126		0.002	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	62933269	87483707	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	ectoderm	endocrine system	endoderm	exocrine system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	46	2	5	1	1	1	36	1	44	33	39	4


RefSeq Transcripts	NM_023952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB040288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF330059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014437 ⟹ ENSRNOP00000014437

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	79,712,520 - 79,716,236 (-)	Ensembl
Rnor_6.0 Ensembl	4	80,391,785 - 80,395,502 (-)	Ensembl

RefSeq Acc Id:

NM_023952 ⟹ NP_076442

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	81,043,128 - 81,047,045 (-)	NCBI
mRatBN7.2	4	79,712,358 - 79,716,275 (-)	NCBI
Rnor_6.0	4	80,391,785 - 80,395,476 (-)	NCBI
Rnor_5.0	4	145,061,114 - 145,064,805 (-)	NCBI
RGSC_v3.4	4	78,886,521 - 78,890,237 (-)	RGD
Celera	4	74,619,146 - 74,622,862 (-)	RGD

Sequence:

show sequence

ATGGAAATTATTTCATCAAAGCGATTCATTTTATTGACTTTAGCAACTTCAAGCTTCTTAACTTCAAACACCCTTTGTTCAGATGAATTAATGATGCCCCATTTTCACAGCAAAGAAGGTTATGGAAA
ATATTACCAGCTGAGAGGAATCCCAAAAGGGGTAAAGGAAAGAAGTGTCACTTTTCAAGAACTCAAAGATTGGGGGGCAAAGAAAGATATTAAGATGAGTCCAGCCCCTGCCAACAAAGTGCCCCACT
CAGCAGCCAACCTTCCCCTGAGGTTTGGGAGGAACATAGAAGACAGAAGAAGCCCCAGGGCACGGGCCAACATGGAGGCAGGGACCATGAGCCATTTTCCCAGCCTGCCCCAAAGGTTTGGGAGAACA
ACAGCCAGACGCATCACCAAGACACTGGCTGGTTTGCCCCAGAAATCCCTGCACTCCCTGGCCTCCAGTGAATTGCTCTATGCCATGACCCGCCAGCATCAAGAAATTCAGAGTCCTGGTCAAGAGCA
ACCTAGGAAACGGGTGTTCACGGAAACAGATGATGCAGAAAGGAAACAAGAAAAAATAGGAAACCTCCAGCCAGTCCTTCAAGGGGCTATGAAGCTGTGA

hide sequence


Protein RefSeqs	NP_076442	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK94203	(Get FASTA)	NCBI Sequence Viewer
	BAB17672	(Get FASTA)	NCBI Sequence Viewer
	EDL88193	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014437
GenBank Protein	Q9ESQ9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_076442 ⟸ NM_023952
- Peptide Label:	precursor
- UniProtKB:	Q9ESQ9 (UniProtKB/Swiss-Prot), Q920A3 (UniProtKB/Swiss-Prot), G3V7F7 (UniProtKB/TrEMBL), A6K0M5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEIISSKRFILLTLATSSFLTSNTLCSDELMMPHFHSKEGYGKYYQLRGIPKGVKERSVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRFGRNIEDRRSPRARANMEAGTMSHFPSLPQRFGRT TARRITKTLAGLPQKSLHSLASSELLYAMTRQHQEIQSPGQEQPRKRVFTETDDAERKQEKIGNLQPVLQGAMKL hide sequence

Ensembl Acc Id:

ENSRNOP00000014437 ⟸ ENSRNOT00000014437

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9ESQ9-F1-model_v2	AlphaFold	Q9ESQ9	1-203	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-44881	BioCyc
Ensembl Genes	ENSRNOG00000010806	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014437	ENTREZGENE
InterPro	FMRFamide-related/fGRP	UniProtKB/Swiss-Prot
KEGG Report	rno:60570	UniProtKB/Swiss-Prot
NCBI Gene	60570	ENTREZGENE
PANTHER	PRO-FMRFAMIDE-RELATED NEUROPEPTIDE VF	UniProtKB/Swiss-Prot
	PTHR14403	UniProtKB/Swiss-Prot
PhenoGen	Npvf	PhenoGen
RatGTEx	ENSRNOG00000010806	RatGTEx
UniProt	A6K0M5	ENTREZGENE, UniProtKB/TrEMBL
	G3V7F7	ENTREZGENE, UniProtKB/TrEMBL
	Q920A3	ENTREZGENE
	Q9ESQ9	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q920A3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-18	Npvf	neuropeptide VF precursor	Rfrp	RFamide-related peptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Rfrp	RFamide-related peptide			Name updated	70584	APPROVED

Note Type	Note	Reference
gene_expression	expressed only in the neurons between the dorsomedial hypothalamic and ventromedial hypothalamic nucleus	628488
gene_function	a preferred ligand for Gpr74 (NPFF receptor FF1)	628488

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar