Symbol:
Urod
Name:
uroporphyrinogen decarboxylase
RGD ID:
3946
Description:
Enables ferrous iron binding activity and uroporphyrinogen decarboxylase activity. Involved in several processes, including response to estradiol; response to fungicide; and uroporphyrinogen III metabolic process. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Biomarker of porphyria and porphyria cutanea tarda. Human ortholog(s) of this gene implicated in porphyria cutanea tarda. Orthologous to human UROD (uroporphyrinogen decarboxylase); PARTICIPATES IN heme biosynthetic pathway; acute intermittent porphyria pathway; erythropoietic porphyria pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
porphyrinogen carboxy-lyase; porphyrinogen carboxylase; UPD; URO-D; uroporphyrinogen III decarboxylase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,701,294 - 135,705,380 (-) NCBI GRCr8 mRatBN7.2 5 130,464,695 - 130,468,783 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,455,217 - 130,468,808 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 133,095,323 - 133,099,413 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,849,929 - 134,854,019 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,872,344 - 134,876,434 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,855,429 - 135,859,515 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,855,433 - 135,859,643 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,650,563 - 139,654,649 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 137,296,410 - 137,300,496 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 137,301,638 - 137,305,678 (-) NCBI Celera 5 128,991,227 - 128,995,309 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Urod Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of UROD mRNA] CTD PMID:31150632 Urod Rat 1,2-dimethylhydrazine decreases expression ISO Urod (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of UROD mRNA CTD PMID:22206623 Urod Rat 1,2-dimethylhydrazine multiple interactions ISO Urod (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UROD mRNA CTD PMID:22206623 Urod Rat 17alpha-ethynylestradiol increases activity EXP 6480464 Ethinyl Estradiol results in increased activity of UROD protein CTD PMID:3945969 Urod Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of UROD mRNA CTD PMID:29097150 Urod Rat 17alpha-ethynylestradiol multiple interactions EXP 6480464 Iron inhibits the reaction [Ethinyl Estradiol results in increased activity of UROD protein] CTD PMID:3945969 Urod Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of UROD mRNA CTD PMID:26496021 Urod Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of UROD mRNA CTD PMID:32145629 Urod Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Urod (Mus musculus) 6480464 Iron-Dextran Complex promotes the reaction [Tetrachlorodibenzodioxin results in decreased activity of UROD protein] CTD PMID:9443932 Urod Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Urod (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of UROD mRNA CTD PMID:21570461 Urod Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Urod (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of UROD mRNA CTD PMID:18163543 and PMID:28213091 Urod Rat 2,3,7,8-tetrachlorodibenzodioxine decreases activity ISO Urod (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased activity of UROD protein CTD PMID:9443932 Urod Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of UROD protein CTD PMID:15928459 Urod Rat 2-butoxyethanol increases expression ISO Urod (Mus musculus) 6480464 n-butoxyethanol results in increased expression of UROD mRNA CTD PMID:19812364 Urod Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO UROD (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of UROD protein CTD PMID:31675489 Urod Rat 4,4'-sulfonyldiphenol increases expression ISO Urod (Mus musculus) 6480464 bisphenol S results in increased expression of UROD mRNA CTD PMID:39298647 Urod Rat 4,4'-sulfonyldiphenol increases expression ISO UROD (Homo sapiens) 6480464 bisphenol S results in increased expression of UROD protein CTD PMID:34186270 Urod Rat 5-aminolevulinic acid decreases activity ISO Urod (Mus musculus) 6480464 Aminolevulinic Acid results in decreased activity of UROD protein CTD PMID:8937451 Urod Rat 5-aminolevulinic acid multiple interactions ISO Urod (Mus musculus) 6480464 Hexachlorobenzene promotes the reaction [Aminolevulinic Acid results in decreased activity of UROD protein] CTD PMID:8937451 Urod Rat 5-fluorouracil decreases response to substance ISO UROD (Homo sapiens) 6480464 UROD protein results in decreased susceptibility to Fluorouracil CTD PMID:21270338 Urod Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of UROD mRNA CTD PMID:31881176 Urod Rat aflatoxin B1 increases expression ISO Urod (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of UROD mRNA CTD PMID:19770486 Urod Rat alcohol decreases activity ISO UROD (Homo sapiens) 6480464 Alcohols results in decreased activity of UROD protein CTD PMID:12030801 Urod Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of UROD mRNA CTD PMID:16483693 Urod Rat aristolochic acid A increases expression ISO UROD (Homo sapiens) 6480464 aristolochic acid I results in increased expression of UROD mRNA and aristolochic acid I results in increased expression of UROD protein CTD PMID:33212167 Urod Rat arsane multiple interactions ISO UROD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UROD mRNA CTD PMID:39836092 Urod Rat arsenic atom multiple interactions ISO UROD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UROD mRNA CTD PMID:39836092 Urod Rat arsenite(3-) multiple interactions ISO UROD (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to UROD mRNA] CTD PMID:32406909 Urod Rat arsenous acid decreases expression ISO UROD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of UROD protein CTD PMID:19364129 Urod Rat atrazine decreases expression ISO UROD (Homo sapiens) 6480464 Atrazine results in decreased expression of UROD mRNA CTD PMID:22378314 Urod Rat barium(0) affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Barium CTD PMID:16325539 Urod Rat beta-lapachone increases expression ISO UROD (Homo sapiens) 6480464 beta-lapachone results in increased expression of UROD mRNA CTD PMID:38218311 Urod Rat beta-lapachone decreases expression ISO UROD (Homo sapiens) 6480464 beta-lapachone results in decreased expression of UROD mRNA CTD PMID:38218311 Urod Rat bis(2-chloroethyl) sulfide increases expression ISO Urod (Mus musculus) 6480464 Mustard Gas results in increased expression of UROD mRNA CTD PMID:15674844 Urod Rat bis(2-ethylhexyl) phthalate increases expression ISO Urod (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of UROD mRNA CTD PMID:33754040 Urod Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of UROD mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of UROD mRNA CTD PMID:26496021 Urod Rat bisphenol A increases expression ISO UROD (Homo sapiens) 6480464 bisphenol A results in increased expression of UROD protein CTD PMID:37567409 Urod Rat bisphenol A decreases expression ISO UROD (Homo sapiens) 6480464 bisphenol A results in decreased expression of UROD protein CTD PMID:31675489 Urod Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of UROD mRNA CTD PMID:32145629 Urod Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of UROD mRNA CTD PMID:30816183 more ... Urod Rat bisphenol A decreases methylation ISO Urod (Mus musculus) 6480464 bisphenol A results in decreased methylation of UROD promoter CTD PMID:27312807 Urod Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of UROD gene CTD PMID:28505145 Urod Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of UROD mRNA CTD PMID:25181051 Urod Rat Bisphenol B increases expression ISO UROD (Homo sapiens) 6480464 bisphenol B results in increased expression of UROD protein CTD PMID:34186270 Urod Rat cadmium atom multiple interactions ISO UROD (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of UROD mRNA CTD PMID:35301059 Urod Rat cadmium dichloride multiple interactions ISO UROD (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of UROD mRNA CTD PMID:35301059 Urod Rat CGP 52608 multiple interactions ISO UROD (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to UROD gene] CTD PMID:28238834 Urod Rat chloropicrin increases expression ISO UROD (Homo sapiens) 6480464 chloropicrin results in increased expression of UROD mRNA CTD PMID:26352163 Urod Rat cisplatin decreases response to substance ISO UROD (Homo sapiens) 6480464 UROD protein results in decreased susceptibility to Cisplatin CTD PMID:21270338 Urod Rat coumarin increases phosphorylation ISO UROD (Homo sapiens) 6480464 coumarin results in increased phosphorylation of UROD protein CTD PMID:35688186 Urod Rat cyclosporin A increases expression ISO Urod (Mus musculus) 6480464 Cyclosporine results in increased expression of UROD mRNA CTD PMID:19770486 Urod Rat decabromodiphenyl ether decreases expression ISO UROD (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of UROD protein CTD PMID:31675489 Urod Rat dextran sulfate multiple interactions ISO Urod (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of UROD protein] CTD PMID:35362542 Urod Rat dextran sulfate increases expression ISO Urod (Mus musculus) 6480464 Dextran Sulfate results in increased expression of UROD protein CTD PMID:35362542 Urod Rat diarsenic trioxide decreases expression ISO UROD (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of UROD protein CTD PMID:19364129 Urod Rat diazinon increases methylation ISO UROD (Homo sapiens) 6480464 Diazinon results in increased methylation of UROD gene CTD PMID:22964155 Urod Rat diuron increases expression EXP 6480464 Diuron results in increased expression of UROD mRNA CTD PMID:21551480 Urod Rat enzyme inhibitor multiple interactions ISO UROD (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of UROD protein CTD PMID:23301498 Urod Rat Evodiamine multiple interactions ISO Urod (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of UROD protein] CTD PMID:35362542 Urod Rat folic acid multiple interactions ISO Urod (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of UROD mRNA CTD PMID:22206623 Urod Rat fomesafen decreases activity ISO Urod (Mus musculus) 6480464 fomesafen results in decreased activity of UROD protein CTD PMID:12758057 Urod Rat hexachlorobenzene affects expression EXP 6480464 Hexachlorobenzene affects the expression of UROD mRNA CTD PMID:15159207 Urod Rat hexachlorobenzene multiple interactions ISO Urod (Mus musculus) 6480464 Hexachlorobenzene promotes the reaction [Aminolevulinic Acid results in decreased activity of UROD protein] CTD PMID:8937451 Urod Rat iron atom decreases activity ISO UROD (Homo sapiens) 6480464 Iron results in decreased activity of UROD protein CTD PMID:12030801 Urod Rat iron atom multiple interactions EXP 6480464 Iron inhibits the reaction [Ethinyl Estradiol results in increased activity of UROD protein] CTD PMID:3945969 Urod Rat iron dextran multiple interactions ISO Urod (Mus musculus) 6480464 Iron-Dextran Complex promotes the reaction [Tetrachlorodibenzodioxin results in decreased activity of UROD protein] CTD PMID:9443932 Urod Rat iron(0) decreases activity ISO UROD (Homo sapiens) 6480464 Iron results in decreased activity of UROD protein CTD PMID:12030801 Urod Rat iron(0) multiple interactions EXP 6480464 Iron inhibits the reaction [Ethinyl Estradiol results in increased activity of UROD protein] CTD PMID:3945969 Urod Rat ivermectin decreases expression ISO UROD (Homo sapiens) 6480464 Ivermectin results in decreased expression of UROD protein CTD PMID:32959892 Urod Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of UROD mRNA CTD PMID:15372504 Urod Rat magnesium atom affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Magnesium CTD PMID:16325539 Urod Rat mercury atom decreases activity ISO UROD (Homo sapiens) 6480464 Mercury results in decreased activity of UROD protein CTD PMID:15967199 Urod Rat mercury(0) decreases activity ISO UROD (Homo sapiens) 6480464 Mercury results in decreased activity of UROD protein CTD PMID:15967199 Urod Rat methyl methanesulfonate increases expression ISO UROD (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of UROD mRNA CTD PMID:23649840 Urod Rat methylmercury chloride decreases expression ISO UROD (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of UROD mRNA CTD PMID:28001369 Urod Rat monosodium L-glutamate multiple interactions ISO Urod (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of UROD mRNA CTD PMID:22078008 Urod Rat monosodium L-glutamate increases expression ISO Urod (Mus musculus) 6480464 Sodium Glutamate results in increased expression of UROD mRNA CTD PMID:22078008 Urod Rat naphthalenes decreases activity EXP 6480464 Naphthalenes results in decreased activity of UROD protein CTD PMID:29663608 Urod Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of UROD mRNA CTD PMID:33484710 Urod Rat Nodakenin multiple interactions ISO UROD (Homo sapiens) 6480464 nodakenin binds to and affects the activity of UROD protein CTD PMID:23209648 Urod Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of UROD mRNA CTD PMID:25729387 Urod Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UROD mRNA CTD PMID:25729387 Urod Rat paclitaxel decreases response to substance ISO UROD (Homo sapiens) 6480464 UROD protein results in decreased susceptibility to Paclitaxel CTD PMID:21270338 Urod Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of UROD protein CTD PMID:16538041 Urod Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of UROD mRNA CTD PMID:33387578 Urod Rat paracetamol decreases expression ISO UROD (Homo sapiens) 6480464 Acetaminophen results in decreased expression of UROD mRNA CTD PMID:21420995 and PMID:29067470 Urod Rat paracetamol affects expression ISO Urod (Mus musculus) 6480464 Acetaminophen affects the expression of UROD mRNA CTD PMID:17562736 Urod Rat phosphorus atom affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Phosphorus CTD PMID:16325539 Urod Rat phosphorus(.) affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Phosphorus CTD PMID:16325539 Urod Rat pirinixic acid increases expression ISO Urod (Mus musculus) 6480464 pirinixic acid results in increased expression of UROD mRNA CTD PMID:17426115 Urod Rat polysulfur affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Sulfur CTD PMID:16325539 Urod Rat quercetin increases expression ISO UROD (Homo sapiens) 6480464 Quercetin results in increased expression of UROD mRNA CTD PMID:21632981 Urod Rat reactive oxygen species decreases abundance ISO UROD (Homo sapiens) 6480464 UROD protein results in decreased abundance of Reactive Oxygen Species CTD PMID:21270338 Urod Rat resveratrol multiple interactions ISO UROD (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of UROD mRNA CTD PMID:23557933 Urod Rat scopolin multiple interactions ISO UROD (Homo sapiens) 6480464 scopolin binds to and affects the activity of UROD protein CTD PMID:23209648 Urod Rat sodium arsenite increases expression ISO Urod (Mus musculus) 6480464 sodium arsenite results in increased expression of UROD protein CTD PMID:29044176 Urod Rat sodium arsenite multiple interactions ISO UROD (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of UROD mRNA CTD PMID:39836092 Urod Rat sodium arsenite decreases expression ISO UROD (Homo sapiens) 6480464 sodium arsenite results in decreased expression of UROD mRNA CTD PMID:38568856 Urod Rat sodium fluoride decreases expression ISO Urod (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of UROD protein CTD PMID:28918527 Urod Rat sulfur atom affects abundance ISO UROD (Homo sapiens) 6480464 UROD protein affects the abundance of Sulfur CTD PMID:16325539 Urod Rat sunitinib decreases expression ISO UROD (Homo sapiens) 6480464 Sunitinib results in decreased expression of UROD mRNA CTD PMID:31533062 Urod Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of UROD mRNA CTD PMID:26496021 Urod Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of UROD mRNA] CTD PMID:31150632 Urod Rat tetrachloromethane decreases expression ISO Urod (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of UROD mRNA CTD PMID:31919559 Urod Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of UROD mRNA CTD PMID:31150632 Urod Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of UROD mRNA CTD PMID:34492290 Urod Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of UROD mRNA CTD PMID:25729387 Urod Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of UROD mRNA CTD PMID:25729387 Urod Rat triptonide increases expression ISO Urod (Mus musculus) 6480464 triptonide results in increased expression of UROD mRNA CTD PMID:33045310 Urod Rat valproic acid affects expression ISO Urod (Mus musculus) 6480464 Valproic Acid affects the expression of UROD mRNA CTD PMID:17292431 Urod Rat valproic acid decreases expression ISO UROD (Homo sapiens) 6480464 Valproic Acid results in decreased expression of UROD mRNA CTD PMID:29154799 Urod Rat vincristine decreases expression ISO UROD (Homo sapiens) 6480464 Vincristine results in decreased expression of UROD mRNA CTD PMID:23649840 Urod Rat vitamin E increases activity ISO UROD (Homo sapiens) 6480464 Vitamin E results in increased activity of UROD protein CTD PMID:12030801
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,5-hexanedione (EXP) 2-butoxyethanol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aminolevulinic acid (ISO) 5-fluorouracil (ISO) acetamide (EXP) aflatoxin B1 (ISO) alcohol (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) barium(0) (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chloropicrin (ISO) cisplatin (ISO) coumarin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (ISO) diuron (EXP) enzyme inhibitor (ISO) Evodiamine (ISO) folic acid (ISO) fomesafen (ISO) hexachlorobenzene (EXP,ISO) iron atom (EXP,ISO) iron dextran (ISO) iron(0) (EXP,ISO) ivermectin (ISO) L-ascorbic acid (EXP) magnesium atom (ISO) mercury atom (ISO) mercury(0) (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) monosodium L-glutamate (ISO) naphthalenes (EXP) nitrofen (EXP) Nodakenin (ISO) oxaliplatin (EXP) paclitaxel (ISO) paracetamol (EXP,ISO) phosphorus atom (ISO) phosphorus(.) (ISO) pirinixic acid (ISO) polysulfur (ISO) quercetin (ISO) reactive oxygen species (ISO) resveratrol (ISO) scopolin (ISO) sodium arsenite (ISO) sodium fluoride (ISO) sulfur atom (ISO) sunitinib (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) topotecan (EXP) triptonide (ISO) valproic acid (ISO) vincristine (ISO) vitamin E (ISO)
Biological Process
cellular response to arsenic-containing substance (IEP) heme A biosynthetic process (IEA,ISO) heme B biosynthetic process (IEA,ISO) heme biosynthetic process (IBA,IC,IEA,ISO,NAS) heme metabolic process (IEA,ISO) heme O biosynthetic process (IEA,ISO) liver development (IEP) porphyrin-containing compound biosynthetic process (IDA,IEA) porphyrin-containing compound catabolic process (IEA,ISO,ISS) porphyrin-containing compound metabolic process (IEA,ISO) protoporphyrinogen IX biosynthetic process (IEA,ISO) response to amine (IEP) response to estradiol (IEP) response to ethanol (IEP) response to fungicide (IEP) response to iron ion (IEP) response to mercury ion (IEP) response to methylmercury (IEP) uroporphyrinogen III metabolic process (IDA)
1.
Arsenite alters heme synthesis in long-term cultures of adult rat hepatocytes.
Aguilar-Gonzalez MG, etal., Toxicol Sci. 1999 Jun;49(2):281-9.
2.
Biosynthesis of heme in mammals.
Ajioka RS, etal., Biochim Biophys Acta. 2006 Jul;1763(7):723-36. Epub 2006 Jun 3.
3.
Synthesis, delivery and regulation of eukaryotic heme and Fe-S cluster cofactors.
Barupala DP, etal., Arch Biochem Biophys. 2016 Feb 15;592:60-75. doi: 10.1016/j.abb.2016.01.010. Epub 2016 Jan 16.
4.
Rat-liver porphyrinogen carboxy-lyase inhibition as a function of the degree of hexachlorobenzene-induced porphyria.
Billi SC, etal., IARC Sci Publ. 1986;(77):487-91.
5.
Activation of uroporphyrinogen decarboxylase by ferrous iron in porphyria cutanea tarda.
Blekkenhorst GH, etal., S Afr Med J. 1979 Nov 24;56(22):918-20.
6.
Effects of iron overload on bile secretion and hepatic porphyrin metabolism in ethinyl estradiol-treated rats.
Cantoni L, etal., Toxicology. 1986 Feb;38(2):187-96.
7.
Comparison between crab hepatopancreas and rat liver uroporphyrinogen decarboxylase.
Chaufan G, etal., Comp Biochem Physiol B Biochem Mol Biol. 2002 Oct;133(2):251-6.
8.
Abnormal kinetic behavior of uroporphyrinogen decarboxylase obtained from rats with hexachlorobenzene-induced porphyria.
Chaufan G, etal., J Biochem Mol Toxicol. 2005;19(1):19-24.
9.
Decreased activity of hepatic uroporphyrinogen decarboxylase in sporadic porphyria cutanea tarda.
Elder GH, etal., N Engl J Med. 1978 Aug 10;299(6):274-8.
10.
A point mutation in the coding region of uroporphyrinogen decarboxylase associated with familial porphyria cutanea tarda.
Garey JR, etal., Blood. 1989 Mar;73(4):892-5.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
GenMAPP: Gene Map Annotator and Pathway Profiler
GenMAPP
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Effects of hexachlorobenzene feeding and iron overload on enzymes of haem biosynthesis and cytochrome P 450 in rat liver.
Louw M, etal., Clin Sci Mol Med. 1977 Aug;53(2):111-5.
15.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
16.
Heme biosynthesis in human breast cancer--mimetic "in vitro" studies and some heme enzymic activity levels.
Navone NM, etal., Int J Biochem. 1990;22(12):1407-11.
17.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
21.
Effect of in vivo administered hexachlorobenzene on epidermal growth factor receptor levels, protein tyrosine kinase activity, and phosphotyrosine content in rat liver.
Randi AS, etal., Biochem Pharmacol. 2003 May 1;65(9):1495-506.
22.
GOA pipeline
RGD automated data pipeline
23.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Comprehensive gene review and curation
RGD comprehensive gene curation
26.
The decrease in uroporphyrinogen decarboxylase activity induced by ethanol predisposes rats to the development of porphyria and accelerates xenobiotic-triggered porphyria, regardless of hepatic damage.
Rios de Molina MC, etal., Braz J Med Biol Res. 2002 Nov;35(11):1273-83.
27.
Rat uroporphyrinogen decarboxylase cDNA: nucleotide sequence and comparison to human uroporphyrinogen decarboxylase.
Romana M, etal., Nucleic Acids Res 1987 Sep 11;15(17):7211.
28.
Distinction between octachlorostyrene and hexachlorobenzene in their potentials to induce ethoxyphenoxazone deethylase and cause porphyria in rats and mice.
Smith AG, etal., J Biochem Toxicol. 1986 Mar;1(1):105-17.
29.
Hexachlorobenzene treatment on hepatic mitochondrial function parameters and intracellular coproporphyrinogen oxidase location.
Sopena YE, etal., Int J Toxicol. 2008 Nov;27(6):455-65.
30.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
31.
Effect of alpha lipoic acid amide on hexachlorobenzene porphyria.
Vilas GL, etal., Biochem Mol Biol Int. 1999 May;47(5):815-23.
32.
Mechanism of hexachlorobenzene-induced porphyria in rats. Effect of phenobarbitone pretreatment.
Wainstok de Calmanovici R, etal., Biochem J. 1984 Mar 15;218(3):753-63.
33.
Metal alteration of uroporphyrinogen decarboxylase and coproporphyrinogen oxidase.
Woods JS and Fowler BA, Ann N Y Acad Sci. 1987;514:55-64.
34.
Developmental aspects of hepatic heme biosynthetic capability and hematotoxicity-II. Studies on uroporphyrinogen decarboxylase.
Woods JS and Kardish RM, Biochem Pharmacol. 1983 Jan 1;32(1):73-8.
35.
Response of uroporphyrinogen decarboxylase to the hematopoietic demands of the spleen.
Woods JS and Kardish RM, Res Commun Chem Pathol Pharmacol. 1985 Jun;48(3):389-400.
36.
Studies on porphyrin metabolism in the kidney. Effects of trace metals and glutathione on renal uroporphyrinogen decarboxylase.
Woods JS, etal., Mol Pharmacol. 1984 Sep;26(2):336-41.
Urod Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 135,701,294 - 135,705,380 (-) NCBI GRCr8 mRatBN7.2 5 130,464,695 - 130,468,783 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 130,455,217 - 130,468,808 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 133,095,323 - 133,099,413 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,849,929 - 134,854,019 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,872,344 - 134,876,434 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,855,429 - 135,859,515 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,855,433 - 135,859,643 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 139,650,563 - 139,654,649 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 137,296,410 - 137,300,496 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 137,301,638 - 137,305,678 (-) NCBI Celera 5 128,991,227 - 128,995,309 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
UROD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 45,012,254 - 45,015,575 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 45,010,950 - 45,015,575 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 45,477,926 - 45,481,247 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 45,250,417 - 45,253,928 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 45,147,012 - 45,150,434 NCBI Celera 1 43,760,589 - 43,764,125 (+) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 43,589,865 - 43,593,401 (+) NCBI HuRef CHM1_1 1 45,594,383 - 45,597,919 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 44,882,726 - 44,887,169 (+) NCBI T2T-CHM13v2.0
Urod Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 116,847,161 - 116,851,561 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 116,847,162 - 116,851,610 (-) Ensembl GRCm39 Ensembl GRCm38 4 116,989,965 - 116,994,436 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,989,965 - 116,994,413 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 116,662,822 - 116,666,980 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 116,488,150 - 116,492,292 (-) NCBI MGSCv36 mm8 Celera 4 115,725,715 - 115,729,873 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.41 NCBI
Urod Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 13,221,551 - 13,229,253 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 13,226,271 - 13,228,908 (-) NCBI ChiLan1.0 ChiLan1.0
UROD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 181,792,058 - 181,795,527 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 180,933,533 - 180,936,999 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 44,315,912 - 44,319,356 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 45,679,744 - 45,683,185 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 45,679,744 - 45,683,185 (+) Ensembl panpan1.1 panPan2
UROD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 15,313,808 - 15,317,130 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 15,312,674 - 15,320,010 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 15,434,370 - 15,437,815 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 15,468,964 - 15,472,409 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 15,468,979 - 15,472,392 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 15,265,932 - 15,269,377 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 15,333,857 - 15,337,302 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 15,406,026 - 15,409,471 (-) NCBI UU_Cfam_GSD_1.0
Urod Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 60,382,374 - 60,385,817 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 26,207,169 - 26,210,623 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 26,207,169 - 26,210,599 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
UROD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 166,327,247 - 166,330,614 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 166,327,243 - 166,330,558 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 153,911,652 - 153,914,966 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
UROD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 87,772,685 - 87,776,110 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 87,772,261 - 87,775,978 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 29,169,582 - 29,173,007 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Urod
.
Predicted Target Of
Count of predictions: 77 Count of miRNA genes: 63 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000024719 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Urod
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q36 UniSTS
RH135227
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 130,465,465 - 130,465,682 (+) MAPPER mRatBN7.2 Rnor_6.0 5 135,856,200 - 135,856,416 NCBI Rnor6.0 Rnor_5.0 5 139,651,334 - 139,651,550 UniSTS Rnor5.0 RGSC_v3.4 5 137,297,181 - 137,297,397 UniSTS RGSC3.4 Celera 5 128,991,998 - 128,992,214 UniSTS RH 3.4 Map 5 836.1 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000024719 ⟹ ENSRNOP00000024719
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,464,697 - 130,468,783 (-) Ensembl Rnor_6.0 Ensembl 5 135,855,433 - 135,859,643 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106708 ⟹ ENSRNOP00000093051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,464,697 - 130,468,536 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114152 ⟹ ENSRNOP00000091280
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 130,455,217 - 130,468,808 (-) Ensembl
RefSeq Acc Id:
NM_019209 ⟹ NP_062082
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 135,701,294 - 135,705,380 (-) NCBI mRatBN7.2 5 130,464,695 - 130,468,783 (-) NCBI Rnor_6.0 5 135,855,429 - 135,859,515 (-) NCBI Rnor_5.0 5 139,650,563 - 139,654,649 (-) NCBI RGSC_v3.4 5 137,296,410 - 137,300,496 (-) RGD Celera 5 128,991,227 - 128,995,309 (-) RGD
Sequence:
TCAGATTAAAGCGGTGACCGCTCAGTTACTGTTTACCATGGAGGCGAACGGCTTGGGACTCCAGAATTTCCCGGAGCTGAAGAATGACACGTTCTTGAGAGCAGCCTGGGGAGAGGAAACAGACTATA
hide sequence
RefSeq Acc Id:
XM_039109371 ⟹ XP_038965299
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 135,701,297 - 135,704,279 (-) NCBI mRatBN7.2 5 130,464,696 - 130,467,861 (-) NCBI
RefSeq Acc Id:
NP_062082 ⟸ NM_019209
- UniProtKB:
P32362 (UniProtKB/Swiss-Prot), B0BN55 (UniProtKB/TrEMBL), F1LMP0 (UniProtKB/TrEMBL), A0A9K3Y7K6 (UniProtKB/TrEMBL)
- Sequence:
MEANGLGLQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLERLRDPAAVA
hide sequence
Ensembl Acc Id:
ENSRNOP00000024719 ⟸ ENSRNOT00000024719
RefSeq Acc Id:
XP_038965299 ⟸ XM_039109371
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000091280 ⟸ ENSRNOT00000114152
Ensembl Acc Id:
ENSRNOP00000093051 ⟸ ENSRNOT00000106708
RGD ID: 13693944 Promoter ID: EPDNEW_R4469 Type: multiple initiation site Name: Urod_1 Description: uroporphyrinogen decarboxylase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 135,859,492 - 135,859,552 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Urod
uroporphyrinogen decarboxylase
Name updated
70584 APPROVED
