Advanced Search (OLGA)

Gene: St8sia1 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1) Rattus norvegicus

Analyze

Symbol:

St8sia1

Name:

ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1

RGD ID:

3679

Description:

Enables sialyltransferase activity. Predicted to be involved in N-glycan processing; oligosaccharide metabolic process; and protein glycosylation. Predicted to act upstream of or within cellular response to heat and positive regulation of epithelial cell proliferation. Predicted to be located in Golgi membrane. Orthologous to human ST8SIA1 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1); PARTICIPATES IN ganglioside metabolic pathway; globoside metabolic pathway; lacto-series glycosphingolipid metabolic pathway; INTERACTS WITH acetamide; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-2, 8-sialytransferase; alpha-2,8-sialyltransferase; alpha-N-acetylneuraminate: alpha-2,8-sialytransferase; alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; GD3 synthase; sialyltransferase 8 (alpha-2 8-sialytransferase) A; Sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-28-sialytransferase GD3 synthase); sialyltransferase 8 A; Sialyltransferase 8 A (alpha-N-acetylneuraminate: alpha-28-sialytransferase GD3 synthase) GenBank no: U53883; Sialyltransferase 8a; Siat8; Siat8a; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,513,966 - 177,651,553 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	177,520,926 - 177,651,553 (-)	Ensembl				GRCr8
mRatBN7.2	4	175,782,989 - 175,921,338 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,789,947 - 175,920,708 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	182,084,919 - 182,215,399 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,869,195 - 177,999,668 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,489,766 - 176,620,240 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	177,065,266 - 177,195,942 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	177,065,168 - 177,196,180 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	241,274,072 - 241,403,150 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	180,722,382 - 180,852,639 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	164,320,658 - 164,451,184 (-)	NCBI		Celera
RGSC_v3.1	4	180,967,505 - 181,097,763 (-)	NCBI
Cytogenetic Map	4	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

liver disease (ISO)

toxic encephalopathy (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (ISO)

calcitriol (ISO)

carmustine (ISO)

Cuprizon (EXP)

cycloheximide (ISO)

DDE (ISO)

DDT (EXP)

decabromodiphenyl ether (EXP)

Dibutyl phosphate (ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

emodin (ISO)

malathion (EXP)

methapyrilene (ISO)

methoxychlor (EXP)

miglustat (ISO)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nitrobenzenes (EXP)

ozone (ISO)

paracetamol (EXP)

permethrin (EXP)

progesterone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to heat (ISO)

glycoprotein biosynthetic process (IEA)

lipid metabolic process (IEA)

N-glycan processing (IBA)

oligosaccharide metabolic process (IBA)

positive regulation of cell population proliferation (ISO)

sphingolipid metabolic process (IEA)

Cellular Component

Golgi membrane (IEA)

Molecular Function

alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity (IBA,IEA,ISO)

glycosyltransferase activity (IEA)

protein binding (ISO)

sialyltransferase activity (IDA,IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ganglioside metabolic pathway (IEA)

globoside metabolic pathway (IEA)

lacto-series glycosphingolipid metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Beta-amyloid-induced synthesis of the ganglioside GD3 is a requisite for cell cycle reactivation and apoptosis in neurons.	Copani A, etal., J Neurosci 2002 May 15;22(10):3963-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.	The molecular cloning and expression of alpha 2,8-sialyltransferase (GD3 synthase) in a rat brain.	Watanabe Y, etal., J Biochem (Tokyo) 1996 Nov;120(5):1020-7.
10.	Molecular cloning of cDNA for rat brain GD3-synthase.	Zeng G, etal., Biochem Biophys Res Commun 1996 Sep 13;226(2):319-23.

Additional References at PubMed

PMID:15645117	PMID:15748692	PMID:18755693

Genomics

Comparative Map Data

St8sia1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	177,513,966 - 177,651,553 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	177,520,926 - 177,651,553 (-)	Ensembl				GRCr8
mRatBN7.2	4	175,782,989 - 175,921,338 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	175,789,947 - 175,920,708 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	182,084,919 - 182,215,399 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	177,869,195 - 177,999,668 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	176,489,766 - 176,620,240 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	177,065,266 - 177,195,942 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	177,065,168 - 177,196,180 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	241,274,072 - 241,403,150 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	180,722,382 - 180,852,639 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	164,320,658 - 164,451,184 (-)	NCBI		Celera
RGSC_v3.1	4	180,967,505 - 181,097,763 (-)	NCBI
Cytogenetic Map	4	q44	NCBI

ST8SIA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	22,193,391 - 22,334,707 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	22,063,773 - 22,437,041 (-)	Ensembl			hg38	GRCh38
GRCh37	12	22,346,325 - 22,487,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	22,245,200 - 22,378,915 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	27,500,769 - 27,642,080 (-)	NCBI		Celera
Cytogenetic Map	12	p12.1	NCBI
HuRef	12	22,119,372 - 22,260,647 (-)	NCBI		HuRef
CHM1_1	12	22,311,335 - 22,452,993 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	22,071,418 - 22,212,735 (-)	NCBI		T2T-CHM13v2.0

St8sia1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	142,767,267 - 142,935,247 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	142,767,271 - 142,910,178 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	142,821,541 - 142,989,528 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	142,821,545 - 142,964,452 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	142,770,061 - 142,912,972 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	142,778,763 - 142,921,674 (-)	NCBI		MGSCv36	mm8
Celera	6	145,883,284 - 146,020,842 (-)	NCBI		Celera
Cytogenetic Map	6	G3	NCBI
cM Map	6	74.78	NCBI

St8sia1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	17,672,460 - 17,805,623 (-)	Ensembl
ChiLan1.0	NW_004955413	17,667,434 - 17,810,671 (-)	NCBI	ChiLan1.0	ChiLan1.0

ST8SIA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	74,434,500 - 74,618,644 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	74,430,888 - 74,615,043 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	63,972,127 - 64,112,083 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	66,578,598 - 66,712,240 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	66,578,949 - 66,712,240 (+)	Ensembl			panPan2	panpan1.1

ST8SIA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	24,879,103 - 25,027,014 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	24,879,380 - 25,023,618 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	21,333,527 - 21,483,378 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	25,096,491 - 25,246,504 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	25,096,525 - 25,238,358 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	24,894,560 - 25,045,533 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	24,918,605 - 25,068,657 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	21,502,984 - 21,653,212 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

St8sia1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	86,748,403 - 86,880,894 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936548	4,671,284 - 4,796,426 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936548	4,671,257 - 4,797,917 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ST8SIA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	51,211,336 - 51,358,144 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	51,211,312 - 51,364,226 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ST8SIA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	22,035,111 - 22,172,244 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	22,035,661 - 22,170,548 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666069	12,973,699 - 13,108,791 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

St8sia1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	16,483,378 - 16,633,776 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	16,483,168 - 16,633,938 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

St8sia1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	596,739 - 725,945 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in St8sia1
803 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	29
Interacting mature miRNAs:	31
Transcripts:	ENSRNOT00000018999
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	176806581	181925369	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	160623982	184426481	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat

Markers in Region

D4Wox46

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	175,921,306 - 175,921,441 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	177,196,672 - 177,196,806	NCBI	Rnor6.0
Rnor_5.0	4	241,403,880 - 241,404,014	UniSTS	Rnor5.0
RGSC_v3.4	4	180,853,618 - 180,853,752	UniSTS	RGSC3.4
Celera	4	164,451,883 - 164,452,017	UniSTS
Cytogenetic Map	4	q44	UniSTS

GDB:455130

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,386,550 - 33,386,634 (+)	MAPPER	mRatBN7.2
mRatBN7.2	4	175,792,841 - 175,793,184 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	177,068,161 - 177,068,503	NCBI	Rnor6.0
Rnor_6.0	12	38,833,759 - 38,833,842	NCBI	Rnor6.0
Rnor_5.0	12	40,734,471 - 40,734,554	UniSTS	Rnor5.0
Rnor_5.0	4	241,276,967 - 241,277,309	UniSTS	Rnor5.0
RGSC_v3.4	4	180,725,277 - 180,725,619	UniSTS	RGSC3.4
RGSC_v3.4	12	34,552,174 - 34,552,257	UniSTS	RGSC3.4
Celera	12	35,067,439 - 35,067,522	UniSTS
Celera	4	164,323,553 - 164,323,938	UniSTS
Cytogenetic Map	12	q16	UniSTS
Cytogenetic Map	4	q44	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	67	163	90	89	58	92	58	6	352	191	11	137	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012813	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107103	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB556962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D45255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U53883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018999 ⟹ ENSRNOP00000018999

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	177,520,926 - 177,651,553 (-)	Ensembl
mRatBN7.2 Ensembl	4	175,789,947 - 175,920,577 (-)	Ensembl
Rnor_6.0 Ensembl	4	177,065,168 - 177,196,180 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100059 ⟹ ENSRNOP00000081373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	175,878,573 - 175,920,708 (-)	Ensembl

RefSeq Acc Id:

NM_012813 ⟹ NP_036945

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	177,520,926 - 177,651,553 (-)	NCBI
mRatBN7.2	4	175,789,947 - 175,920,577 (-)	NCBI
Rnor_6.0	4	177,065,266 - 177,195,942 (-)	NCBI
Rnor_5.0	4	241,274,072 - 241,403,150 (-)	NCBI
RGSC_v3.4	4	180,722,382 - 180,852,639 (-)	RGD
Celera	4	164,320,658 - 164,451,184 (-)	NCBI

Sequence:

show sequence

GGCCCCACTGCTCTCAGACCCCTTCAGCGCCCACTGTCTGCAGGGAAAGAGACCAAGGCTCGTG
ATTTGCCCGGAGGCCACTTCCTCTAGCAAGACATCCCAGTAAAAGTTGCATTGGCGAAGATCCT
TGTAGCTGACCTCTGAAGCCGTGGCGTGGGGGTTCCCCAGTCGTGCGTGTGCGAGCTGGAAAGC
CAAAGGTGTGTGTGCATGGGGGGCCAGCCACTGGGGCATTCTCCGCTGCCACTTTGCCCGGCGT
TGTGCTGAGGCTGCCACCACTGACCCTGGGACACCGAGGCTGCGATGAGCCCCTGCGGGCGGGC
CCTACATACATCCAGAGGGGCCATGGCCATGCTGGCGCGGAAATTCCCGCGTACCCGGCTACCC
GTGGGAGCCAGTGCCCTCTGTGTGGTGGTCCTCTGTTGGCTCTATGTCTTCCCTGTCTACCGGC
TGCCCAACGAGAAGGAGATCGTGCAAGGAGTGCTGGCGCAGCGCACAGCTTGGAGGAGGAACCA
GACGTCAGCCAGGCTCTTCAGGAAACAAATGGAAGACTGCTGCAACCCCGCCCATCTCTTTGCA
ATGACGAAGGTGAACTCCCCCATGGGGAAGAGCCTGTGGTATGACGGGGAGTTTCTATACTCGC
TCACCATCGACAACTCCACGTACTCCCTCTTCCCCCAGGCAACCCCCTTCCAGCTGCCATTGAA
GAAATGTGCGGTGGTGGGAAACGGTGGGATTCTGAAGATGAGTGGCTGTGGCCGTCAAATAGAT
GAAGCAAATTTTGTCATGCGGTGTAACCTTCCTCCCTTGTCAAGTGAATACACCAGAGATGTGG
GTTCCAAGACTCAGTTGGTGACAGCTAACCCCAGCATAATTCGCCAGAGATTTGAAAACCTGCT
GTGGTCCAGAAAGAAGTTTGTGGACAACATGAAGATCTATAACCACAGTTACATATACATGCCT
GCCTTTTCTATGAAGACGGGAACAGAGCCGTCTCTCCGTGTGTACTACACCCTGAAAGACGCTG
GAGCCAATCAAACAGTGCTTTTTGCTAACCCCAACTTTCTTCGAAACATTGGAAAGTTCTGGAA
GGGTAGGGGGATCCATGCCAAGCGCCTGTCTACAGGACTCTTTTTGGTGAGTGCAGCCTTGGGC
CTTTGTGAGGAGGTGTCCATCTACGGCTTCTGGCCCTTCTCCGTGAACATGCAAGGGGAACCTA
TCAGCCACCATTACTATGACAACGTCTTGCCCTTCTCAGGCTTCCATGCCATGCCTGAGGAGTT
TCTTCAACTCTGGTATCTTCATAAAATGGGTGCACTGAGGATGCAACTGGACCCATGTGAGGAG
CCGTCGCCGCCACAGCCCACTTCCTAGGGACTGCAGAAGAGGAAAAGACTGGATGGGGGTATTT
TTTTGCTAGATTTTTTTTTATGTGACTTTCAAAAGGAGCTGCCAAAGTGTGTCATGGATTGGCG

hide sequence

RefSeq Acc Id:

XM_039107103 ⟹ XP_038963031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	177,513,966 - 177,651,159 (-)	NCBI
mRatBN7.2	4	175,782,989 - 175,921,338 (-)	NCBI

RefSeq Acc Id:

XM_039107104 ⟹ XP_038963032

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	177,513,966 - 177,597,394 (-)	NCBI
mRatBN7.2	4	175,782,989 - 175,867,514 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_036945	(Get FASTA)	NCBI Sequence Viewer
	XP_038963031	(Get FASTA)	NCBI Sequence Viewer
	XP_038963032	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC27541	(Get FASTA)	NCBI Sequence Viewer
	BAA08213	(Get FASTA)	NCBI Sequence Viewer
	EDM01472	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018999
	ENSRNOP00000018999.4

RefSeq Acc Id:

NP_036945 ⟸ NM_012813

- UniProtKB:

G3V7T2 (UniProtKB/TrEMBL), A6IMW7 (UniProtKB/TrEMBL), P70554 (UniProtKB/TrEMBL), P97713 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYVFPVYRLPNEKEIVQGVLAQR
TAWRRNQTSARLFRKQMEDCCNPAHLFAMTKVNSPMGKSLWYDGEFLYSLTIDNSTYSLFPQAT
PFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIR
QRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDAGANQTVLFANPNFLR
NIGKFWKGRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGEPISHHYYDNVLPFSGF
HAMPEEFLQLWYLHKMGALRMQLDPCEEPSPPQPTS

hide sequence

Ensembl Acc Id:

ENSRNOP00000018999 ⟸ ENSRNOT00000018999

RefSeq Acc Id:	XP_038963031 ⟸ XM_039107103
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038963032 ⟸ XM_039107104
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000081373 ⟸ ENSRNOT00000100059

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7T2-F1-model_v2	AlphaFold	G3V7T2	1-356	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3679	AgrOrtholog
BioCyc Gene	G2FUF-42486	BioCyc
Ensembl Genes	ENSRNOG00000014018	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018999	ENTREZGENE
	ENSRNOT00000018999.7	UniProtKB/TrEMBL
Gene3D-CATH	3.90.1480.20	UniProtKB/TrEMBL
InterPro	Glyco_trans_29	UniProtKB/TrEMBL
	Glycosyltr_29_Sialyltrsf	UniProtKB/TrEMBL
	GT29-like_sf	UniProtKB/TrEMBL
	Sialyl_trans	UniProtKB/TrEMBL
KEGG Report	rno:25280	UniProtKB/TrEMBL
NCBI Gene	25280	ENTREZGENE
PANTHER	ALPHA-2,8-SIALYLTRANSFERASE	UniProtKB/TrEMBL
	ALPHA-N-ACETYLNEURAMINIDE ALPHA-2,8-SIALYLTRANSFERASE	UniProtKB/TrEMBL
Pfam	Glyco_transf_29	UniProtKB/TrEMBL
PhenoGen	St8sia1	PhenoGen
PIRSF	Sialyl_trans	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014018	RatGTEx
TIGR	TC202136
UniProt	A6IMW7	ENTREZGENE, UniProtKB/TrEMBL
	G3V7T2	ENTREZGENE, UniProtKB/TrEMBL
	P70554	ENTREZGENE, UniProtKB/TrEMBL
	P97713	ENTREZGENE
UniProt Secondary	P97713	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-05	St8sia1	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1	St8sia1	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-16	St8sia1	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 1	St8sia1	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	St8sia1	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1			Symbol and Name updated	1299863	APPROVED
2001-06-20	Siat8	Sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase)			Symbol withdrawn, duplicate of Siat8a (RGD:3679)	67952	WITHDRAWN
2001-06-20	Siat8a	Sialyltransferase 8a			Name updated	67952	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may be involved in Alzheimers Disease and Creutzfeldt-Jakob disease since elevated GD3 levels have been seen in the brains from these patients	625459
gene_expression	expressed in cerebral cortex, hippocampus, thalamus, cerebellum and spleen	633966
gene_process	activity is necessary for beta-amyloid peptide induced GD3 upregulation which leads to induction of neuronal apoptosis	625459

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)