Symbol:
Scamp1
Name:
secretory carrier membrane protein 1
RGD ID:
3625
Description:
Enables protein domain specific binding activity. Involved in endocytosis. Located in clathrin-coated vesicle. Is active in synaptic vesicle membrane. Orthologous to human SCAMP1 (secretory carrier membrane protein 1); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
SCAMP 37; secretory carrier-associated membrane protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 27,168,863 - 27,251,637 (-) NCBI GRCr8 mRatBN7.2 2 25,433,958 - 25,516,734 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 25,433,959 - 25,516,673 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 32,462,075 - 32,546,022 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 30,562,340 - 30,646,287 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 25,386,298 - 25,470,239 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 23,858,021 - 23,941,128 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 23,857,995 - 23,941,084 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 43,029,910 - 43,112,204 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 24,495,965 - 24,586,869 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 24,417,965 - 24,507,158 (-) NCBI Celera 2 21,507,437 - 21,588,695 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scamp1 Rat (1->4)-beta-D-glucan multiple interactions ISO Scamp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SCAMP1 mRNA CTD PMID:36331819 Scamp1 Rat 1,2-dichloroethane decreases expression ISO Scamp1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SCAMP1 mRNA CTD PMID:28189721 and PMID:28960355 Scamp1 Rat 1,2-dimethylhydrazine decreases expression ISO Scamp1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SCAMP1 mRNA CTD PMID:22206623 Scamp1 Rat 17alpha-ethynylestradiol affects expression ISO Scamp1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of SCAMP1 mRNA CTD PMID:17555576 Scamp1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SCAMP1 mRNA CTD PMID:15212814 Scamp1 Rat 17alpha-ethynylestradiol increases expression ISO Scamp1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SCAMP1 mRNA CTD PMID:17942748 Scamp1 Rat 17alpha-ethynylestradiol multiple interactions ISO Scamp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCAMP1 mRNA CTD PMID:17942748 Scamp1 Rat 17beta-estradiol increases expression ISO Scamp1 (Mus musculus) 6480464 Estradiol results in increased expression of SCAMP1 mRNA CTD PMID:39298647 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SCAMP1 mRNA CTD PMID:18061397 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SCAMP1 mRNA CTD PMID:34747641 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Scamp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SCAMP1 mRNA CTD PMID:21570461 and PMID:26377647 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SCAMP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SCAMP1 mRNA CTD PMID:22298810 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Scamp1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SCAMP1 mRNA CTD PMID:17942748 Scamp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Scamp1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SCAMP1 mRNA and [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of SCAMP1 mRNA CTD PMID:17942748 and PMID:25975270 Scamp1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SCAMP1 mRNA CTD PMID:21346803 Scamp1 Rat 2-bromohexadecanoic acid multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SCAMP1 protein] CTD PMID:38195004 Scamp1 Rat 2-methylcholine affects expression ISO SCAMP1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of SCAMP1 mRNA CTD PMID:21179406 Scamp1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Scamp1 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Scamp1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of SCAMP1 mRNA CTD PMID:19162173 Scamp1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Scamp1 (Mus musculus) 6480464 bisphenol S results in decreased expression of SCAMP1 mRNA CTD PMID:39298647 Scamp1 Rat all-trans-retinoic acid decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SCAMP1 mRNA CTD PMID:15498508 and PMID:33167477 Scamp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SCAMP1 mRNA CTD PMID:16483693 Scamp1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SCAMP1 mRNA CTD PMID:30779732 Scamp1 Rat aristolochic acid A decreases expression ISO SCAMP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SCAMP1 mRNA CTD PMID:33212167 Scamp1 Rat benzo[a]pyrene decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SCAMP1 mRNA CTD PMID:18061397 Scamp1 Rat benzo[a]pyrene increases methylation ISO Scamp1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of SCAMP1 exon and Benzo(a)pyrene results in increased methylation of SCAMP1 intron CTD PMID:27901495 Scamp1 Rat benzo[a]pyrene increases expression ISO Scamp1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SCAMP1 mRNA CTD PMID:22228805 Scamp1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO SCAMP1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Scamp1 Rat beta-lapachone decreases expression ISO SCAMP1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SCAMP1 mRNA CTD PMID:38218311 Scamp1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SCAMP1 mRNA CTD PMID:18164116 Scamp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SCAMP1 mRNA CTD PMID:25181051 Scamp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SCAMP1 gene CTD PMID:28505145 Scamp1 Rat cadmium atom multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SCAMP1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SCAMP1 protein CTD PMID:38195004 Scamp1 Rat cadmium dichloride decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SCAMP1 mRNA CTD PMID:18560533 Scamp1 Rat cadmium dichloride multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SCAMP1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of SCAMP1 protein CTD PMID:38195004 Scamp1 Rat cadmium sulfate multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SCAMP1 mRNA CTD PMID:18654764 Scamp1 Rat caffeine decreases phosphorylation ISO SCAMP1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SCAMP1 protein CTD PMID:35688186 Scamp1 Rat calcitriol increases expression ISO SCAMP1 (Homo sapiens) 6480464 Calcitriol results in increased expression of SCAMP1 mRNA CTD PMID:16002434 Scamp1 Rat CGP 52608 multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SCAMP1 gene] CTD PMID:28238834 Scamp1 Rat chromium(6+) affects expression ISO Scamp1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of SCAMP1 mRNA CTD PMID:28472532 Scamp1 Rat cisplatin decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SCAMP1 mRNA CTD PMID:27594783 Scamp1 Rat clodronic acid increases expression ISO SCAMP1 (Homo sapiens) 6480464 Clodronic Acid results in increased expression of SCAMP1 mRNA CTD PMID:25596134 Scamp1 Rat cobalt dichloride multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SCAMP1 mRNA CTD PMID:18654764 Scamp1 Rat cobalt dichloride increases expression ISO SCAMP1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SCAMP1 mRNA CTD PMID:17553155 and PMID:19376846 Scamp1 Rat copper(II) sulfate decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SCAMP1 mRNA CTD PMID:19549813 Scamp1 Rat coumarin decreases phosphorylation ISO SCAMP1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of SCAMP1 protein CTD PMID:35688186 Scamp1 Rat cyclosporin A decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SCAMP1 mRNA CTD PMID:25596134 Scamp1 Rat dextran sulfate decreases expression ISO Scamp1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of SCAMP1 protein CTD PMID:32272095 Scamp1 Rat dextran sulfate multiple interactions ISO Scamp1 (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in decreased expression of SCAMP1 protein] CTD PMID:32272095 Scamp1 Rat diazinon increases methylation ISO SCAMP1 (Homo sapiens) 6480464 Diazinon results in increased methylation of SCAMP1 gene CTD PMID:22964155 Scamp1 Rat Dibutyl phosphate affects expression ISO SCAMP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SCAMP1 mRNA CTD PMID:37042841 Scamp1 Rat dicrotophos decreases expression ISO SCAMP1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of SCAMP1 mRNA CTD PMID:28302478 Scamp1 Rat dioxygen increases expression ISO SCAMP1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of SCAMP1 mRNA CTD PMID:25596134 Scamp1 Rat dorsomorphin multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SCAMP1 mRNA CTD PMID:27188386 Scamp1 Rat elemental selenium decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Selenium results in decreased expression of SCAMP1 mRNA CTD PMID:19244175 Scamp1 Rat ethanol affects splicing ISO Scamp1 (Mus musculus) 6480464 Ethanol affects the splicing of SCAMP1 mRNA CTD PMID:30319688 Scamp1 Rat fenofibrate decreases expression EXP 6480464 Fenofibrate results in decreased expression of SCAMP1 mRNA CTD PMID:25596134 Scamp1 Rat fenthion decreases expression ISO Scamp1 (Mus musculus) 6480464 Fenthion results in decreased expression of SCAMP1 mRNA CTD PMID:34813904 Scamp1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of SCAMP1 mRNA CTD PMID:24136188 Scamp1 Rat folic acid decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of SCAMP1 mRNA CTD PMID:21867686 Scamp1 Rat formaldehyde decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SCAMP1 mRNA CTD PMID:23649840 Scamp1 Rat FR900359 increases phosphorylation ISO SCAMP1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SCAMP1 protein CTD PMID:37730182 Scamp1 Rat isotretinoin decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of SCAMP1 mRNA CTD PMID:20436886 Scamp1 Rat ivermectin decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SCAMP1 protein CTD PMID:32959892 Scamp1 Rat lead diacetate multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of SCAMP1 mRNA CTD PMID:22839698 Scamp1 Rat lead(0) increases expression ISO SCAMP1 (Homo sapiens) 6480464 Lead results in increased expression of SCAMP1 mRNA CTD PMID:19921347 Scamp1 Rat lead(II) chloride multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [cadmium sulfate co-treated with cobaltous chloride co-treated with lead chloride] results in increased expression of SCAMP1 mRNA CTD PMID:18654764 Scamp1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of SCAMP1 mRNA CTD PMID:25596134 Scamp1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of SCAMP1 mRNA CTD PMID:30467583 Scamp1 Rat methidathion decreases expression ISO Scamp1 (Mus musculus) 6480464 methidathion results in decreased expression of SCAMP1 mRNA CTD PMID:34813904 Scamp1 Rat methyl methanesulfonate decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SCAMP1 mRNA CTD PMID:23649840 Scamp1 Rat methylmercury chloride decreases expression ISO SCAMP1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SCAMP1 mRNA CTD PMID:28001369 Scamp1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SCAMP1 mRNA CTD PMID:18164116 Scamp1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of SCAMP1 mRNA CTD PMID:24136188 Scamp1 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of SCAMP1 mRNA CTD PMID:24136188 Scamp1 Rat nitrates multiple interactions ISO Scamp1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SCAMP1 mRNA CTD PMID:35964746 Scamp1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Scamp1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SCAMP1 mRNA CTD PMID:36331819 Scamp1 Rat phenobarbital increases expression ISO Scamp1 (Mus musculus) 6480464 Phenobarbital results in increased expression of SCAMP1 mRNA CTD PMID:19270015 Scamp1 Rat phenylmercury acetate decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of SCAMP1 mRNA CTD PMID:26272509 Scamp1 Rat phenylmercury acetate multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SCAMP1 mRNA CTD PMID:27188386 Scamp1 Rat pirinixic acid multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of SCAMP1 mRNA CTD PMID:19710929 Scamp1 Rat propiconazole decreases expression ISO Scamp1 (Mus musculus) 6480464 propiconazole results in decreased expression of SCAMP1 mRNA CTD PMID:21278054 Scamp1 Rat SB 431542 multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of SCAMP1 mRNA CTD PMID:27188386 Scamp1 Rat selenium atom decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Selenium results in decreased expression of SCAMP1 mRNA CTD PMID:19244175 Scamp1 Rat sodium fluoride increases expression ISO Scamp1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of SCAMP1 protein CTD PMID:28918527 Scamp1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SCAMP1 mRNA CTD PMID:19281266 Scamp1 Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of SCAMP1 mRNA CTD PMID:24136188 Scamp1 Rat sunitinib increases expression ISO SCAMP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of SCAMP1 mRNA CTD PMID:31533062 Scamp1 Rat tamibarotene affects expression ISO SCAMP1 (Homo sapiens) 6480464 tamibarotene affects the expression of SCAMP1 mRNA CTD PMID:15498508 Scamp1 Rat testosterone decreases expression ISO SCAMP1 (Homo sapiens) 6480464 Testosterone results in decreased expression of SCAMP1 mRNA CTD PMID:33359661 Scamp1 Rat testosterone enanthate affects expression ISO SCAMP1 (Homo sapiens) 6480464 testosterone enanthate affects the expression of SCAMP1 mRNA CTD PMID:17440010 Scamp1 Rat tetrachloromethane increases expression ISO Scamp1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of SCAMP1 mRNA CTD PMID:27339419 Scamp1 Rat titanium dioxide decreases methylation ISO Scamp1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SCAMP1 promoter CTD PMID:35295148 Scamp1 Rat trimellitic anhydride decreases expression ISO Scamp1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of SCAMP1 mRNA CTD PMID:19042947 Scamp1 Rat uranium atom affects expression ISO SCAMP1 (Homo sapiens) 6480464 Uranium affects the expression of SCAMP1 mRNA CTD PMID:15672453 Scamp1 Rat valproic acid increases expression ISO SCAMP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SCAMP1 mRNA CTD PMID:23179753 and PMID:27188386 Scamp1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SCAMP1 mRNA CTD PMID:23034163 Scamp1 Rat zinc protoporphyrin multiple interactions ISO SCAMP1 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of SCAMP1 mRNA CTD PMID:22839698
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-methylcholine (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) caffeine (ISO) calcitriol (ISO) CGP 52608 (ISO) chromium(6+) (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) dextran sulfate (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) elemental selenium (ISO) ethanol (ISO) fenofibrate (EXP) fenthion (ISO) finasteride (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) isotretinoin (ISO) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) lead(II) chloride (ISO) metformin (EXP) methapyrilene (EXP) methidathion (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nimesulide (EXP) nitrates (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propiconazole (ISO) SB 431542 (ISO) selenium atom (ISO) sodium fluoride (ISO) Soman (EXP) sulindac (EXP) sunitinib (ISO) tamibarotene (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) uranium atom (ISO) valproic acid (ISO) vinclozolin (EXP) zinc protoporphyrin (ISO)
Cellular Component
clathrin-coated vesicle (IDA) cytoplasmic vesicle membrane (IEA,ISO) endosome (IEA) Golgi apparatus (IEA) membrane (IEA,ISO,ISS) recycling endosome membrane (IBA,IEA,ISO,ISS) synapse (IEA,ISO) synaptic vesicle membrane (IDA,IEA,IEP,ISO) terminal bouton (HDA) trans-Golgi network (IEA,ISO,ISS) trans-Golgi network membrane (IBA) zymogen granule membrane (IEA,ISO)
1.
The SNARE Vti1a-beta is localized to small synaptic vesicles and participates in a novel SNARE complex.
Antonin W, etal., J Neurosci 2000 Aug 1;20(15):5724-32.
2.
SCAMP 37, a new marker within the general cell surface recycling system.
Brand SH and Castle JD, EMBO J 1993 Oct;12(10):3753-61.
3.
Novel SCAMPs lacking NPF repeats: ubiquitous and synaptic vesicle-specific forms implicate SCAMPs in multiple membrane-trafficking functions.
Fernandez-Chacon R and Sudhof TC, J Neurosci 2000 Nov 1;20(21):7941-50.
4.
SCAMP1 function in endocytosis.
Fernandez-Chacon R, etal., J Biol Chem 2000 Apr 28;275(17):12752-6.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.
Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.
Scamp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 27,168,863 - 27,251,637 (-) NCBI GRCr8 mRatBN7.2 2 25,433,958 - 25,516,734 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 25,433,959 - 25,516,673 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 32,462,075 - 32,546,022 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 30,562,340 - 30,646,287 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 25,386,298 - 25,470,239 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 23,858,021 - 23,941,128 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 23,857,995 - 23,941,084 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 43,029,910 - 43,112,204 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 24,495,965 - 24,586,869 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 24,417,965 - 24,507,158 (-) NCBI Celera 2 21,507,437 - 21,588,695 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
SCAMP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 78,360,617 - 78,480,739 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 78,360,611 - 78,480,739 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 77,656,441 - 77,776,562 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 77,692,095 - 77,812,318 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 77,692,109 - 77,810,634 NCBI Celera 5 73,549,557 - 73,669,746 (+) NCBI Celera Cytogenetic Map 5 q14.1 NCBI HuRef 5 72,862,994 - 72,983,412 (+) NCBI HuRef CHM1_1 5 77,089,800 - 77,209,865 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 78,842,266 - 78,962,217 (+) NCBI T2T-CHM13v2.0
Scamp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 94,337,818 - 94,422,339 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 94,337,818 - 94,422,365 (-) Ensembl GRCm39 Ensembl GRCm38 13 94,201,310 - 94,285,831 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 94,201,310 - 94,285,857 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 94,971,388 - 95,055,236 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 95,302,187 - 95,385,980 (-) NCBI MGSCv36 mm8 Celera 13 97,823,776 - 97,903,581 (-) NCBI Celera Cytogenetic Map 13 C3 NCBI cM Map 13 49.22 NCBI
Scamp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955425 22,564,978 - 22,686,564 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955425 22,562,336 - 22,686,661 (-) NCBI ChiLan1.0 ChiLan1.0
SCAMP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 36,826,248 - 36,948,208 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 34,979,875 - 35,101,829 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 36,829,770 - 36,951,827 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 37,318,534 - 37,440,069 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 37,316,593 - 37,439,785 (-) Ensembl panpan1.1 panPan2
SCAMP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 28,296,229 - 28,417,398 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 28,274,205 - 28,417,496 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 29,537,222 - 29,659,052 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 28,219,559 - 28,341,457 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 28,219,561 - 28,341,444 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 28,155,981 - 28,277,572 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 28,134,141 - 28,255,794 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 28,461,468 - 28,583,360 (-) NCBI UU_Cfam_GSD_1.0
Scamp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 184,468,493 - 184,567,955 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936549 6,291,151 - 6,391,952 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936549 6,291,063 - 6,389,000 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SCAMP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 87,210,846 - 87,316,112 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 87,210,839 - 87,313,520 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 88,980,416 - 89,058,271 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SCAMP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 72,613,178 - 72,731,614 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 72,613,197 - 72,733,884 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 21,453,862 - 21,579,432 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scamp1
.
Predicted Target Of
Count of predictions: 927 Count of miRNA genes: 335 Interacting mature miRNAs: 456 Transcripts: ENSRNOT00000014602 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat
RH136851
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,435,659 - 25,435,875 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,859,723 - 23,859,938 NCBI Rnor6.0 Rnor_5.0 2 43,031,612 - 43,031,827 UniSTS Rnor5.0 RGSC_v3.4 2 24,497,667 - 24,497,882 UniSTS RGSC3.4 Celera 2 21,509,139 - 21,509,354 UniSTS Cytogenetic Map 2 q12 UniSTS
RH126839
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,501,662 - 25,501,882 (+) MAPPER mRatBN7.2 mRatBN7.2 7 9,319,929 - 9,320,149 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,926,119 - 23,926,338 NCBI Rnor6.0 Rnor_6.0 7 12,186,015 - 12,186,234 NCBI Rnor6.0 Rnor_5.0 7 12,356,070 - 12,356,289 UniSTS Rnor5.0 Rnor_5.0 2 43,097,162 - 43,097,381 UniSTS Rnor5.0 RGSC_v3.4 2 24,571,860 - 24,572,079 UniSTS RGSC3.4 RGSC_v3.4 7 10,831,227 - 10,831,446 UniSTS RGSC3.4 Celera 7 7,498,632 - 7,498,851 UniSTS Celera 2 21,573,686 - 21,573,905 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 2 q12 UniSTS
RH132413
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,434,124 - 25,434,316 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,858,188 - 23,858,379 NCBI Rnor6.0 Rnor_5.0 2 43,030,077 - 43,030,268 UniSTS Rnor5.0 RGSC_v3.4 2 24,496,132 - 24,496,323 UniSTS RGSC3.4 Celera 2 21,507,604 - 21,507,795 UniSTS Cytogenetic Map 2 q12 UniSTS
RH133854
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,501,655 - 25,501,870 (+) MAPPER mRatBN7.2 mRatBN7.2 7 9,319,922 - 9,320,137 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,926,112 - 23,926,326 NCBI Rnor6.0 Rnor_6.0 7 12,186,008 - 12,186,222 NCBI Rnor6.0 Rnor_5.0 7 12,356,063 - 12,356,277 UniSTS Rnor5.0 Rnor_5.0 2 43,097,155 - 43,097,369 UniSTS Rnor5.0 RGSC_v3.4 2 24,571,853 - 24,572,067 UniSTS RGSC3.4 RGSC_v3.4 7 10,831,220 - 10,831,434 UniSTS RGSC3.4 Celera 7 7,498,625 - 7,498,839 UniSTS Celera 2 21,573,679 - 21,573,893 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 2 q12 UniSTS
Mbd3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 25,501,527 - 25,501,865 (+) MAPPER mRatBN7.2 mRatBN7.2 7 9,319,794 - 9,320,132 (+) MAPPER mRatBN7.2 Rnor_6.0 2 23,925,984 - 23,926,321 NCBI Rnor6.0 Rnor_6.0 7 12,185,880 - 12,186,217 NCBI Rnor6.0 Rnor_5.0 7 12,355,935 - 12,356,272 UniSTS Rnor5.0 Rnor_5.0 2 43,097,027 - 43,097,364 UniSTS Rnor5.0 RGSC_v3.4 2 24,571,725 - 24,572,062 UniSTS RGSC3.4 RGSC_v3.4 7 10,831,092 - 10,831,429 UniSTS RGSC3.4 Celera 7 7,498,497 - 7,498,834 UniSTS Celera 2 21,573,551 - 21,573,888 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 2 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000084044 ⟹ ENSRNOP00000070553
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,433,959 - 25,516,673 (-) Ensembl Rnor_6.0 Ensembl 2 23,860,517 - 23,909,016 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084729 ⟹ ENSRNOP00000071856
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,433,959 - 25,516,673 (-) Ensembl Rnor_6.0 Ensembl 2 23,857,995 - 23,941,084 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000093847 ⟹ ENSRNOP00000086247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,433,959 - 25,516,586 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111881 ⟹ ENSRNOP00000087816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,433,959 - 25,484,860 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115933 ⟹ ENSRNOP00000096839
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 25,433,959 - 25,484,860 (-) Ensembl
RefSeq Acc Id:
NM_001100636 ⟹ NP_001094106
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,168,863 - 27,251,567 (-) NCBI mRatBN7.2 2 25,433,958 - 25,516,673 (-) NCBI Rnor_6.0 2 23,858,021 - 23,941,128 (-) NCBI Rnor_5.0 2 43,029,910 - 43,112,204 (-) NCBI RGSC_v3.4 2 24,495,965 - 24,586,869 (-) RGD Celera 2 21,507,437 - 21,588,695 (-) RGD
Sequence:
CCGGATCTGTGCGGCGGCGGCGGCGACGTGAGCGCGCAGGGGGGCGGCGGCCTCGCCTCGTCTGTGTCTCGGCGCCGGGCTCGGGTGGGTGACGCGCAGTGCCGGGGCAATGTCGGATTTTGACAGCA
hide sequence
RefSeq Acc Id:
XM_039102028 ⟹ XP_038957956
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,168,863 - 27,251,612 (-) NCBI mRatBN7.2 2 25,433,958 - 25,516,734 (-) NCBI
RefSeq Acc Id:
XM_039102030 ⟹ XP_038957958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,168,863 - 27,251,637 (-) NCBI mRatBN7.2 2 25,433,958 - 25,516,734 (-) NCBI
RefSeq Acc Id:
XM_039102031 ⟹ XP_038957959
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 27,168,863 - 27,213,635 (-) NCBI mRatBN7.2 2 25,433,958 - 25,478,734 (-) NCBI
RefSeq Acc Id:
NP_001094106 ⟸ NM_001100636
- UniProtKB:
P56603 (UniProtKB/Swiss-Prot), A0A0G2JY82 (UniProtKB/TrEMBL)
- Sequence:
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFP
hide sequence
Ensembl Acc Id:
ENSRNOP00000071856 ⟸ ENSRNOT00000084729
Ensembl Acc Id:
ENSRNOP00000070553 ⟸ ENSRNOT00000084044
RefSeq Acc Id:
XP_038957956 ⟸ XM_039102028
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A1V6 (UniProtKB/TrEMBL), Q5D009 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957958 ⟸ XM_039102030
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K1I6 (UniProtKB/TrEMBL), A6I4W5 (UniProtKB/TrEMBL), A0A8I6ARE5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957959 ⟸ XM_039102031
- Peptide Label:
isoform X3
- UniProtKB:
Q5D009 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000086247 ⟸ ENSRNOT00000093847
Ensembl Acc Id:
ENSRNOP00000087816 ⟸ ENSRNOT00000111881
Ensembl Acc Id:
ENSRNOP00000096839 ⟸ ENSRNOT00000115933
RGD ID: 13691072 Promoter ID: EPDNEW_R1596 Type: initiation region Name: Scamp1_1 Description: secretory carrier membrane protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 23,941,158 - 23,941,218 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Scamp1
secretory carrier membrane protein 1
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_physical_interaction
binds gamma-synergin and intersectin 1
631946
