Rgs11 (regulator of G-protein signaling 11) - Rat Genome Database

Rgs11 (regulator of G-protein signaling 11) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Rgs11 (regulator of G-protein signaling 11) Rattus norvegicus

Subscribe to Updates

Symbol:

Rgs11

Name:

regulator of G-protein signaling 11

RGD ID:

3563

Description:

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in regulation of G protein-coupled receptor signaling pathway. Predicted to be located in dendrite terminus. Predicted to be part of protein-containing complex. Predicted to be active in cell tip and dendrite. Orthologous to human RGS11 (regulator of G protein signaling 11); INTERACTS WITH 2,4,6-trinitrotoluene; 4-amino-2,6-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding (Ensembl: pseudogene)

RefSeq Status:

Previously known as:

LOC360501

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,727,279 - 15,735,536 (+)	NCBI		GRCr8
mRatBN7.2	10	15,222,804 - 15,231,062 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	15,222,803 - 15,231,060 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	19,962,573 - 19,970,833 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,451,452 - 19,459,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,950,732 - 14,958,986 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_5.0	10	15,383,438 - 15,391,694 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	15,469,922 - 15,478,157 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	15,476,071 - 15,476,346 (+)	NCBI
Celera	10	14,890,608 - 14,898,855 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	morphine dependence	treatment	ISO	RGD:1321341	597830059		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	epilepsy		ISO	RGD:1321340	8554872	ClinVar Annotator: match by term: Epilepsy	ClinVar	PMID:24463883\|PMID:25558065\|PMID:28492532
Rgs11	Rat	Idiopathic Generalized Epilepsy		ISO	RGD:1321340	8554872	ClinVar Annotator: match by term: Idiopathic generalized epilepsy	ClinVar	PMID:28492532
Rgs11	Rat	short-rib thoracic dysplasia 9 with or without polydactyly		ISO	RGD:1321340	8554872	ClinVar Annotator: match by term: Saldino-Mainzer syndrome	ClinVar	PMID:19370764\|PMID:20301784\|PMID:22503633\|PMID:23418020\|PMID:24009529\|PMID:26216056\|PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1321341	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RGS11 mRNA	CTD	PMID:22206623
Rgs11	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1321341	6480464	Ethinyl Estradiol affects the expression of RGS11 mRNA	CTD	PMID:17555576
Rgs11	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of RGS11 mRNA	CTD	PMID:21346803
Rgs11	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2,6-dinitrotoluene affects the expression of RGS11 mRNA	CTD	PMID:21346803
Rgs11	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1321341	6480464	Fenretinide results in increased expression of RGS11 mRNA	CTD	PMID:28973697
Rgs11	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of RGS11 mRNA	CTD	PMID:24780913
Rgs11	Rat	acrylamide	decreases expression	ISO	RGD:1321340	6480464	Acrylamide results in decreased expression of RGS11 mRNA	CTD	PMID:32763439
Rgs11	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of RGS11 mRNA	CTD	PMID:30047161
Rgs11	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of RGS11 mRNA	CTD	PMID:16483693
Rgs11	Rat	antirheumatic drug	increases expression	ISO	RGD:1321340	6480464	Antirheumatic Agents results in increased expression of RGS11 mRNA	CTD	PMID:24449571
Rgs11	Rat	arsenous acid	increases expression	ISO	RGD:1321340	6480464	Arsenic Trioxide results in increased expression of RGS11 mRNA	CTD	PMID:20458559
Rgs11	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1321340	6480464	Benzo(a)pyrene results in decreased methylation of RGS11 3' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Rgs11	Rat	bisphenol A	increases expression	ISO	RGD:1321341	6480464	bisphenol A results in increased expression of RGS11 mRNA	CTD	PMID:29165653
Rgs11	Rat	bisphenol A	decreases expression	ISO	RGD:1321341	6480464	bisphenol A results in decreased expression of RGS11 mRNA	CTD	PMID:32156529
Rgs11	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of RGS11 mRNA	CTD	PMID:19167457
Rgs11	Rat	cadmium atom	multiple interactions	ISO	RGD:1321340	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RGS11 more ...	CTD	PMID:35301059
Rgs11	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1321340	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RGS11 more ...	CTD	PMID:35301059
Rgs11	Rat	calcitriol	increases expression	ISO	RGD:1321340	6480464	Calcitriol results in increased expression of RGS11 mRNA	CTD	PMID:21592394
Rgs11	Rat	calcitriol	multiple interactions	ISO	RGD:1321340	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of RGS11 mRNA	CTD	PMID:21592394
Rgs11	Rat	carbon nanotube	decreases expression	ISO	RGD:1321341	6480464	Nanotubes, Carbon analog results in decreased expression of RGS11 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Rgs11	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of RGS11 mRNA	CTD	PMID:18500788
Rgs11	Rat	cisplatin	decreases expression	ISO	RGD:1321340	6480464	Cisplatin results in decreased expression of RGS11 mRNA	CTD	PMID:27392435
Rgs11	Rat	copper atom	multiple interactions	ISO	RGD:1321340	6480464	[Disulfiram binds to Copper] which results in increased expression of RGS11 mRNA	CTD	PMID:24690739
Rgs11	Rat	copper(0)	multiple interactions	ISO	RGD:1321340	6480464	[Disulfiram binds to Copper] which results in increased expression of RGS11 mRNA	CTD	PMID:24690739
Rgs11	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of RGS11 mRNA	CTD	PMID:26577399
Rgs11	Rat	DDE	decreases expression	ISO	RGD:1321340	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of RGS11 mRNA	CTD	PMID:38568856
Rgs11	Rat	diarsenic trioxide	increases expression	ISO	RGD:1321340	6480464	Arsenic Trioxide results in increased expression of RGS11 mRNA	CTD	PMID:20458559
Rgs11	Rat	disulfiram	multiple interactions	ISO	RGD:1321340	6480464	[Disulfiram binds to Copper] which results in increased expression of RGS11 mRNA	CTD	PMID:24690739
Rgs11	Rat	doxorubicin	decreases expression	ISO	RGD:1321340	6480464	Doxorubicin results in decreased expression of RGS11 mRNA	CTD	PMID:29803840
Rgs11	Rat	fluvastatin	multiple interactions	ISO	RGD:1321340	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of RGS11 mRNA	CTD	PMID:16996129
Rgs11	Rat	folic acid	multiple interactions	ISO	RGD:1321341	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of RGS11 mRNA	CTD	PMID:22206623
Rgs11	Rat	folic acid	increases expression	ISO	RGD:1321340	6480464	Folic Acid results in increased expression of RGS11 mRNA	CTD	PMID:21867686
Rgs11	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of RGS11 mRNA	CTD	PMID:29933104
Rgs11	Rat	ivermectin	decreases expression	ISO	RGD:1321340	6480464	Ivermectin results in decreased expression of RGS11 protein	CTD	PMID:32959892
Rgs11	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of RGS11 mRNA	CTD	PMID:30047161
Rgs11	Rat	morphine	decreases expression	ISO	RGD:1321341	597830059	morphine decreases expression of Rgs11 mRNA in cortex	RGD
Rgs11	Rat	morphine	multiple interactions	ISO	RGD:1321341	597830059	naloxone cotreated with morphine decreases expression of Rgs11 mRNA in brain	RGD
Rgs11	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of RGS11 mRNA	CTD	PMID:28943392
Rgs11	Rat	paracetamol	affects expression	ISO	RGD:1321341	6480464	Acetaminophen affects the expression of RGS11 mRNA	CTD	PMID:17562736
Rgs11	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1321340	6480464	perfluorohexanesulfonic acid results in increased expression of RGS11 mRNA	CTD	PMID:25812627
Rgs11	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:1321340	6480464	perfluorooctanoic acid results in increased expression of RGS11 mRNA	CTD	PMID:25812627
Rgs11	Rat	phenobarbital	decreases expression	EXP		6480464	Phenobarbital results in decreased expression of RGS11 mRNA	CTD	PMID:30047161
Rgs11	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	RGD:1321340	6480464	[Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RGS11 mRNA	CTD	PMID:16979875
Rgs11	Rat	rimonabant	multiple interactions	ISO	RGD:1321341	6480464	Rimonabant inhibits the reaction [Dietary Fats results in increased expression of RGS11 mRNA]	CTD	PMID:19030233
Rgs11	Rat	silicon dioxide	increases expression	ISO	RGD:1321340	6480464	Silicon Dioxide analog results in increased expression of RGS11 mRNA	CTD	PMID:25895662
Rgs11	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of RGS11 mRNA	CTD	PMID:30047161
Rgs11	Rat	sunitinib	decreases expression	ISO	RGD:1321340	6480464	Sunitinib results in decreased expression of RGS11 mRNA	CTD	PMID:31533062
Rgs11	Rat	tamoxifen	affects expression	ISO	RGD:1321341	6480464	Tamoxifen affects the expression of RGS11 mRNA	CTD	PMID:17555576
Rgs11	Rat	testosterone	multiple interactions	ISO	RGD:1321340	6480464	[Testosterone co-treated with Calcitriol] results in increased expression of RGS11 mRNA	CTD	PMID:21592394
Rgs11	Rat	testosterone	decreases expression	ISO	RGD:1321340	6480464	Testosterone results in decreased expression of RGS11 mRNA	CTD	PMID:21592394
Rgs11	Rat	tetraphene	increases expression	ISO	RGD:1321341	6480464	benz(a)anthracene results in increased expression of RGS11 mRNA	CTD	PMID:26377693
Rgs11	Rat	thapsigargin	increases expression	ISO	RGD:1321340	6480464	Thapsigargin results in increased expression of RGS11 mRNA	CTD	PMID:22378314
Rgs11	Rat	thioacetamide	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of RGS11 mRNA	CTD	PMID:28943392
Rgs11	Rat	titanium dioxide	increases expression	ISO	RGD:1321341	6480464	titanium dioxide results in increased expression of RGS11 mRNA	CTD	PMID:23557971
Rgs11	Rat	titanium dioxide	decreases methylation	ISO	RGD:1321341	6480464	titanium dioxide results in decreased methylation of RGS11 gene	CTD	PMID:35295148
Rgs11	Rat	triadimefon	decreases expression	EXP		6480464	triadimefon results in decreased expression of RGS11 mRNA	CTD	PMID:30047161
Rgs11	Rat	triclosan	increases expression	ISO	RGD:1321340	6480464	Triclosan results in increased expression of RGS11 mRNA	CTD	PMID:30510588
Rgs11	Rat	tunicamycin	increases expression	ISO	RGD:1321340	6480464	Tunicamycin results in increased expression of RGS11 mRNA	CTD	PMID:22378314
Rgs11	Rat	valproic acid	increases methylation	ISO	RGD:1321340	6480464	Valproic Acid results in increased methylation of RGS11 gene	CTD	PMID:29154799
Rgs11	Rat	zinc atom	multiple interactions	ISO	RGD:1321340	6480464	[Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RGS11 mRNA	CTD	PMID:16979875
Rgs11	Rat	zinc(0)	multiple interactions	ISO	RGD:1321340	6480464	[Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RGS11 mRNA	CTD	PMID:16979875
Rgs11	Rat	zoledronic acid	multiple interactions	ISO	RGD:1321340	6480464	[zoledronic acid co-treated with fluvastatin] results in increased expression of RGS11 mRNA	CTD	PMID:16996129

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	negative regulation of signal transduction	involved_in	IEA	UniProtKB-KW:KW-0734	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rgs11	Rat	regulation of G protein-coupled receptor signaling pathway		TAS		737641		RGD
Rgs11	Rat	regulation of G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR047016	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	cell tip	is_active_in	ISO	RGD:1321341	1624291	PMID:25997951	RGD	PMID:25997951
Rgs11	Rat	dendrite	is_active_in	ISO	RGD:1321341	1624291	PMID:25997951	RGD	PMID:25997951
Rgs11	Rat	dendrite terminus	located_in	ISO	RGD:1321341	1624291	PMID:22689652	RGD	PMID:22689652
Rgs11	Rat	protein-containing complex	part_of	ISO	RGD:1321340	1624291	PMID:18468998	RGD	PMID:18468998

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rgs11	Rat	G-protein beta-subunit binding	enables	ISO	RGD:1321340	1624291	UniProtKB:O14775 PMID:12606627	RGD	PMID:12606627
Rgs11	Rat	GTPase activator activity		TAS		737641		RGD
Rgs11	Rat	protein binding	enables	ISO	RGD:1321341	1624291	UniProtKB:Q3UVC4 PMID:15897264	RGD	PMID:15897264

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Regulators of G-protein signaling (RGS) proteins: region-specific expression of nine subtypes in rat brain.	Gold SJ, etal., J Neurosci 1997 Oct 15;17(20):8024-37.
3.	EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.	Koelle MR and Horvitz HR, Cell 1996 Jan 12;84(1):115-25.
4.	Expression of neural RGS-R7 and Gbeta5 Proteins in Response to Acute and Chronic Morphine.	López-Fando A, etal., Neuropsychopharmacology. 2005 Jan;30(1):99-110. doi: 10.1038/sj.npp.1300515.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12606627	PMID:18468998	PMID:22689652

Rgs11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,727,279 - 15,735,536 (+)	NCBI		GRCr8
mRatBN7.2	10	15,222,804 - 15,231,062 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	15,222,803 - 15,231,060 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	19,962,573 - 19,970,833 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,451,452 - 19,459,712 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,950,732 - 14,958,986 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_5.0	10	15,383,438 - 15,391,694 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	15,469,922 - 15,478,157 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	15,476,071 - 15,476,346 (+)	NCBI
Celera	10	14,890,608 - 14,898,855 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

RGS11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	268,307 - 275,944 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	268,301 - 275,980 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	318,306 - 325,944 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	258,311 - 265,915 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	258,310 - 265,915	NCBI
Celera	16	518,212 - 525,816 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	236,516 - 243,705 (-)	NCBI		HuRef
CHM1_1	16	318,250 - 325,856 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	263,137 - 270,775 (-)	NCBI		T2T-CHM13v2.0

Rgs11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	26,421,500 - 26,430,295 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	26,421,925 - 26,430,298 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	26,202,527 - 26,211,324 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	26,202,951 - 26,211,324 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	26,339,907 - 26,348,269 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	25,930,541 - 25,938,925 (+)	NCBI		MGSCv36	mm8
Celera	17	26,736,772 - 26,745,093 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	13.07	NCBI

Rgs11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	16,905,982 - 16,914,772 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	16,905,982 - 16,914,772 (+)	NCBI	ChiLan1.0	ChiLan1.0

RGS11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	486,237 - 493,945 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	4,279,108 - 4,286,846 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	259,143 - 266,526 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	259,143 - 266,520 (-)	Ensembl	panpan1.1		panPan2

RGS11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	40,225,910 - 40,233,942 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	40,225,506 - 40,233,936 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	41,489,642 - 41,497,658 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	40,568,394 - 40,576,437 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	40,568,469 - 40,576,429 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	40,256,636 - 40,264,646 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	40,217,686 - 40,225,659 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	40,696,163 - 40,704,193 (+)	NCBI		UU_Cfam_GSD_1.0

Rgs11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	112,541,691 - 112,549,960 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	641,391 - 651,098 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	641,339 - 647,833 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RGS11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	41,402,316 - 41,410,868 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	41,402,345 - 41,410,813 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	41,025,834 - 41,030,124 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RGS11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	214,626 - 222,961 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	214,964 - 223,167 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	30,956,062 - 30,964,390 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rgs11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	1,122,704 - 1,130,869 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624913	1,121,987 - 1,132,313 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

.

Variants in Rgs11
57 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	235
Count of miRNA genes:	158
Interacting mature miRNAs:	175
Transcripts:	ENSRNOT00000027763
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_019338	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CB605941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB786483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY471398	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000100171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	15,222,803 - 15,231,060 (+)	Ensembl

RefSeq Acc Id:

NM_019338 ⟹ NP_062211

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,727,279 - 15,735,536 (+)	NCBI
mRatBN7.2	10	15,222,804 - 15,231,062 (+)	NCBI
Rnor_5.0	10	15,383,438 - 15,391,694 (+)	NCBI
Celera	10	14,890,608 - 14,898,855 (+)	NCBI

Sequence:

show sequence

GAGGTCCGCCATGGCCACGGTTAGAGGCTGCACACCCCATCGCGGGTGCTCCCGAATGCAGAGACCACATCTCAGCAAGATGGAACGGGTGGTCGTGAGTATGCAGGACCCTGACCAGGGCGTGAAGA
TGCGGAGCCAGCGCCTTCTGATCACCGTCATTCCCCACGCGGTGGCGGGCAGAGACATCGTGGAATGGCTGGTCCAGAAGTTCTGCATCTCGGAGGAGGAAGCCCTGCACCTGGGCACACTCCTGACA
CAGCACGGCTACATCTACCCACTGCGTGAGTCCCGAGACCTGACGCTCAGGCCGGACGAGACCCCCTACAGGTTCCAGACACCCTACTTTTGGACAAGCACTCTGTGGCCAGCTGCTGAACTGGACTA
TGCCATCTACCTGGCTAAGAAGAACATCCAAAAACAAGGGGCCTTGGTGGACTATGAGAAGGAACATTACACCCTGCTGCACAAGAAGATCAACCATGCGTGGGATCTAGTATTGATGCAGGCTCGAG
AGCAGCTGCGGGCTGCTAAGCAGCGCAGGAAGGGAGACAGGCTGGTCATTTCGTGTCAGGAGCAGACATACTGGCTGGTGAACAAACCCCCTCCTGGGGCACCTAATGTTCTGGAGCAGGGTCCTGAG
AGGGGTTCTGATAACCCCAGTCAAGTGCAGATGAGCTCGGATTTCTATAAGTGTGAGATCGAGTGCTTCAGGAAGGCGCTGAGCAGGAACCGGGTGAAGTCCTCTGTCTGCCTCGAGGCGTACCTGAA
GTTCAGCAGCCAGCATGGGCCGCACGATCCCATCCTGTCAGGGTGCCTGCCCAGCAACCCCTGGATCACAGACGATGTCACCTACTGGGTCATGAATGCGCCCAATGTGGCTGCCCCGACAAAGCTCC
GCGTCGAGCGATGGAGCTTCAGCTTCCGGGAGCTCCTGGATGACCCCGTGGGGCGTATCCACTTCATGGACTTTCTGCAGAAGGAATTCAGTGCGGAAAACCTCAGCTTCTGGGAGGCGTGTGAGGAG
CTGCGCTTTGGCGGACAGGCCCAGGTCCCCACCCTGGTGGACTCTGTTTACCAGCAGTTCCTGGCCCCTGGAGCTGCCCGCTGGATCAACATTGACAGCAGAACAATGGAGTGGACCCTGGAGGGGCT
GCGCCAGCCACACCGCTATGTCCTAGATGCAGCACAACTGCACATCTACATGCTCATGAAGAAGGACTCCTATCCAAGGTTCCTAAAGTCTGATATCTACAGAGGGCTGCTGGAGGAAGCTGTGATTC
CGCTGGAGACCAAGCGCTGGCCATTCCCATTCTTGCGGAAGCCTCTGCACTCAAGTCCCAGCCCTGCTCTCCAGTCGACCTCTGGGGAGCCTGCAGCTACCAGCTCCCCTGCAGGTGGCAATGAGGAG
GACTAAGTGGCTCTTGCTGCACATGTCACCTTATCATCACCTGCCTGACACCCTGTGGGGTCATGTTCTCCTCACTGAGATACTCCCAGCACTGGTGTCTCCCTGTAGAGGGCCCAGCCTTGCTACGA
GGCCCTTTAGCCTCCACTAAGTAAGCCCTCTCCTTCCCAGAAGGGACTGGCCCAGCTGATTCCTAGGGCAAGATTTCATTGGCTGATCCTTGCCAGGACAGAACTTGTTCTAGGAAGTAAAATCAAGG
TCCTCAGTTCCTGGTATTCTGTAGTCTTCAATTCAGGACTAGGAGGCCATCTCAACCTTAGAAAGTTGTCAGTGACACATGCGGAAGTGTTGTTTCTGGCCATGCCATCCTATTCAGGAGGACTCCTC
CCCTGTGTAACCTACTCCTTAGGCTAAACCCAGTGACTTCTCAGTAGACTATGTGTGCAGATGCCGTTTTACTGCCATACATGGCATCTCGTCCACCTGCCTTCTGACCAGATGTGTAGAAAGGCCAC
TCCACAGTGGTGTCCTGACTGTAGGGCTCCCAGATCTCTTAGCAAGTCTTTGTCAAGCTGGCAGCCGTAGCATCCAGGCTTCCTGTCTAGGTTGTCCTGTGCCACCAGCATTGCCACCCCCACCCCAG
AGGTAGAAATAGAGACGGCACCTCCTTCTGCTATGCAGCTCCCGGCAGGGCTATTCTCTAGTCTCCCTCACAACCCATTCCTACAGAAATGAAAGTTTCAGGCCCTGG

hide sequence


Protein RefSeqs	NP_062211	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52375	(Get FASTA)	NCBI Sequence Viewer
	P49807	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062211 ⟸ NM_019338

- Sequence:

show sequence

MATVRGCTPHRGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDIVEWLVQKFCISEEEALHLGTLLTQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTLWPAAELDYAIY
LAKKNIQKQGALVDYEKEHYTLLHKKINHAWDLVLMQAREQLRAAKQRRKGDRLVISCQEQTYWLVNKPPPGAPNVLEQGPERGSDNPSQVQMSSDFYKCEIECFRKALSRNRVKSSVCLEAYLKFSS
QHGPHDPILSGCLPSNPWITDDVTYWVMNAPNVAAPTKLRVERWSFSFRELLDDPVGRIHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWINIDSRTMEWTLEGLRQP
HRYVLDAAQLHIYMLMKKDSYPRFLKSDIYRGLLEEAVIPLETKRWPFPFLRKPLHSSPSPALQSTSGEPAATSSPAGGNEED

hide sequence

Protein Domains

RGS

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P49807-F1-model_v2	AlphaFold	P49807	1-66	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-25722	BioCyc
Ensembl Genes	ENSRNOG00000066310	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000100171	ENTREZGENE
Gene3D-CATH	1.10.167.10	UniProtKB/Swiss-Prot
InterPro	RGS	UniProtKB/Swiss-Prot
	RGS6/7/9/11	UniProtKB/Swiss-Prot
	RGS_sf	UniProtKB/Swiss-Prot
	RGS_subdomain_2	UniProtKB/Swiss-Prot
NCBI Gene	54291	ENTREZGENE
PANTHER	LP21163P	UniProtKB/Swiss-Prot
	REGULATOR OF G-PROTEIN SIGNALING 11	UniProtKB/Swiss-Prot
Pfam	RGS	UniProtKB/Swiss-Prot
PhenoGen	Rgs11	PhenoGen
PRINTS	RGSPROTEIN	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000066310	RatGTEx
Superfamily-SCOP	SSF48097	UniProtKB/Swiss-Prot
UniProt	P49807	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-06-15	Rgs11	regulator of G-protein signaling 11	Rgs11_predicted	regulator of G-protein signaling 11 (predicted)	Data merged from RGD:1310438	1643240	APPROVED
2005-01-12	Rgs11_predicted	regulator of G-protein signaling 11 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-06-10	Rgs11	regulator of G-protein signaling 11			Name updated	70584	APPROVED

Note Type	Note	Reference
gene_expression	expressed in specific regions of the brain	737641