Advanced Search (OLGA)

Gene: Pygm (glycogen phosphorylase, muscle associated) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pygm

Name:

glycogen phosphorylase, muscle associated

RGD ID:

3461

Description:

Enables carbohydrate binding activity; glycogen phosphorylase activity; and heterocyclic compound binding activity. Involved in several processes, including glycogen catabolic process; response to cAMP; and response to hypoxia. Located in sarcoplasmic reticulum. Used to study cholestasis. Human ortholog(s) of this gene implicated in glycogen storage disease V. Orthologous to human PYGM (glycogen phosphorylase, muscle associated); PARTICIPATES IN glycogen degradation pathway; insulin signaling pathway; starch and sucrose metabolic pathway; INTERACTS WITH (R)-noradrenaline; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glycogen phosphorylase, muscle form; muscle (McArdle syndrome); muscle glycogen phosphorylase; Muscpho; myophosphorylase; Phosphorylase glycogen; Phosphorylase, glycogen; phosphorylase, glycogen, muscle

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PYGM (glycogen phosphorylase, muscle associated)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pygm (muscle glycogen phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pygm (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PYGM (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PYGM (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pygm (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PYGM (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PYGM (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pygm (glycogen phosphorylase, muscle associated)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PYGB (glycogen phosphorylase B)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	PYGM (glycogen phosphorylase, muscle associated)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pygm (muscle glycogen phosphorylase)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pygma (phosphorylase, glycogen, muscle A)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	pygmb (phosphorylase, glycogen, muscle b)	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GPH1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	GlyP	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pygl-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	213,119,805 - 213,134,622 (+)	NCBI		GRCr8
mRatBN7.2	1	203,690,550 - 203,705,369 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	203,690,533 - 203,705,368 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	212,039,387 - 212,054,202 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	219,135,880 - 219,150,695 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	211,826,933 - 211,841,748 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	221,756,325 - 221,771,142 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	221,756,286 - 221,771,143 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	228,737,461 - 228,758,937 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	209,166,701 - 209,181,588 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	209,325,179 - 209,340,017 (+)	NCBI
Celera	1	201,223,967 - 201,238,784 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	cholestasis		IDA		1599990	mRNA:decreased expression:liver	RGD
Pygm	Rat	Experimental Diabetes Mellitus		IDA		1599897	protein:increased expression:sarcoplasmic reticulum	RGD
Pygm	Rat	glycogen storage disease V		ISO	PYGM (Homo sapiens)	1599985	DNA:deletion:exon	RGD
Pygm	Rat	Left Ventricular Hypertrophy		HEP		1599987	mRNA:increased expression:heart left ventricle and cardiac muscle cell	RGD
Pygm	Rat	Myocardial Ischemia		IDA		1599991		RGD
Pygm	Rat	Paralysis		IEP		1599993	mRNA and protein:decreased expression:skeletal muscle	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	Bardet-Biedl syndrome		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:12118255 more ...
Pygm	Rat	genetic disease		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10450796 more ...
Pygm	Rat	glycogen storage disease		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glycogen storage disease	ClinVar	PMID:16924035 more ...
Pygm	Rat	glycogen storage disease V		ISO	PYGM (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10417800 more ...
Pygm	Rat	High Myopia		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Severe Myopia	ClinVar	PMID:25741868 more ...
Pygm	Rat	intellectual disability		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
Pygm	Rat	isolated elevated serum creatine phosphokinase levels		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: HYPERCKEMIA and IDIOPATHIC	ClinVar	PMID:25741868 and PMID:28492532
Pygm	Rat	leukocyte adhesion deficiency 3		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leukocyte adhesion deficiency 3	ClinVar	PMID:28492532
Pygm	Rat	multiple endocrine neoplasia type 1		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Multiple endocrine neoplasia and type 1	ClinVar	PMID:17065424 more ...
Pygm	Rat	myopathy		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Myopathy	ClinVar	PMID:28492532
Pygm	Rat	Rhabdomyolysis		ISO	PYGM (Homo sapiens)	8554872	ClinVar Annotator: match by term: Rhabdomyolysis	ClinVar	PMID:25741868 and PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	glycogen storage disease V		ISO	PYGM (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:12666117 and PMID:18380285
Pygm	Rat	muscular disease		ISO	PYGM (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18380285

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	glycogen storage disease V		ISS	Pygm (Mus musculus)	13592920	OMIM:232600	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	glycogen storage disease V		ISO	PYGM (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PYGM mRNA	CTD	PMID:22079256
Pygm	Rat	(R)-noradrenaline	affects expression	EXP		6480464	Norepinephrine affects the expression of PYGM mRNA	CTD	PMID:14618266
Pygm	Rat	17alpha-ethynylestradiol	affects expression	ISO	Pygm (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of PYGM mRNA	CTD	PMID:17555576
Pygm	Rat	17alpha-ethynylestradiol	increases expression	ISO	Pygm (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of PYGM mRNA	CTD	PMID:17942748
Pygm	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Pygm (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PYGM mRNA	CTD	PMID:17942748
Pygm	Rat	17beta-estradiol	decreases expression	ISO	Pygm (Mus musculus)	6480464	Estradiol results in decreased expression of PYGM mRNA	CTD	PMID:19484750
Pygm	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of PYGM mRNA	CTD	PMID:32145629
Pygm	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	PYGM (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Pygm	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Pygm (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PYGM mRNA	CTD	PMID:17942748
Pygm	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PYGM mRNA	CTD	PMID:32109520
Pygm	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Pygm (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PYGM mRNA	CTD	PMID:21570461
Pygm	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Pygm (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of PYGM mRNA	CTD	PMID:17942748
Pygm	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Pygm	Rat	2,4,6-tribromophenol	increases expression	ISO	PYGM (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Pygm	Rat	2,5-hexanedione	decreases expression	EXP		6480464	2 and 5-hexanedione results in decreased expression of PYGM protein	CTD	PMID:19033394
Pygm	Rat	3,3',5,5'-tetrabromobisphenol A	increases expression	ISO	PYGM (Homo sapiens)	6480464	tetrabromobisphenol A results in increased expression of PYGM protein	CTD	PMID:31675489
Pygm	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Pygm (Mus musculus)	6480464	bisphenol S results in increased expression of PYGM mRNA	CTD	PMID:30951980
Pygm	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	Pygm (Mus musculus)	6480464	bisphenol S affects the methylation of PYGM gene	CTD	PMID:31683443
Pygm	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	Pygm (Mus musculus)	6480464	Fenretinide results in decreased expression of PYGM mRNA	CTD	PMID:16467112
Pygm	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PYGM mRNA	CTD	PMID:24780913
Pygm	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of PYGM mRNA	CTD	PMID:31881176
Pygm	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of PYGM mRNA	CTD	PMID:28959563
Pygm	Rat	aflatoxin B1	increases methylation	ISO	PYGM (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of PYGM exon	CTD	PMID:30157460
Pygm	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of PYGM mRNA	CTD	PMID:35163327
Pygm	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PYGM mRNA	CTD	PMID:35163327
Pygm	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PYGM mRNA	CTD	PMID:16483693
Pygm	Rat	aristolochic acid A	increases expression	ISO	PYGM (Homo sapiens)	6480464	aristolochic acid I results in increased expression of PYGM mRNA	CTD	PMID:33212167
Pygm	Rat	arsenite(3-)	decreases expression	ISO	Pygm (Mus musculus)	6480464	arsenite results in decreased expression of PYGM mRNA	CTD	PMID:33053406
Pygm	Rat	astemizole	increases expression	EXP		6480464	Astemizole results in increased expression of PYGM mRNA	CTD	PMID:20221588
Pygm	Rat	benzo[a]pyrene	decreases expression	ISO	Pygm (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of PYGM mRNA	CTD	PMID:22228805
Pygm	Rat	benzo[a]pyrene	increases expression	ISO	Pygm (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of PYGM mRNA	CTD	PMID:32417428
Pygm	Rat	benzo[a]pyrene	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of PYGM mRNA	CTD	PMID:22316170
Pygm	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Pygm (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of PYGM mRNA	CTD	PMID:28085963
Pygm	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Diethylhexyl Phthalate results in decreased expression of PYGM mRNA	CTD	PMID:31163220
Pygm	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of PYGM mRNA	CTD	PMID:25181051 and PMID:32145629
Pygm	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PYGM mRNA	CTD	PMID:38750585
Pygm	Rat	bisphenol A	increases expression	ISO	PYGM (Homo sapiens)	6480464	bisphenol A results in increased expression of PYGM protein	CTD	PMID:37567409
Pygm	Rat	bisphenol A	decreases expression	ISO	PYGM (Homo sapiens)	6480464	bisphenol A results in decreased expression of PYGM protein	CTD	PMID:31675489
Pygm	Rat	bisphenol A	increases expression	ISO	Pygm (Mus musculus)	6480464	bisphenol A results in increased expression of PYGM mRNA	CTD	PMID:30951980
Pygm	Rat	bisphenol AF	increases expression	ISO	PYGM (Homo sapiens)	6480464	bisphenol AF results in increased expression of PYGM protein	CTD	PMID:34186270
Pygm	Rat	bisphenol F	increases expression	ISO	Pygm (Mus musculus)	6480464	bisphenol F results in increased expression of PYGM mRNA	CTD	PMID:30951980 and PMID:38685157
Pygm	Rat	bromobenzene	decreases expression	EXP		6480464	bromobenzene results in decreased expression of PYGM mRNA	CTD	PMID:32479839
Pygm	Rat	butanal	increases expression	ISO	PYGM (Homo sapiens)	6480464	butyraldehyde results in increased expression of PYGM mRNA	CTD	PMID:26079696
Pygm	Rat	cadmium dichloride	increases expression	ISO	PYGM (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of PYGM mRNA	CTD	PMID:38568856
Pygm	Rat	cantharidin	decreases expression	ISO	Pygm (Mus musculus)	6480464	Cantharidin results in decreased expression of PYGM mRNA	CTD	PMID:36907384
Pygm	Rat	cisplatin	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of PYGM mRNA	CTD	PMID:27392435
Pygm	Rat	cisplatin	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Cisplatin results in decreased expression of PYGM mRNA	CTD	PMID:27392435
Pygm	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of PYGM mRNA	CTD	PMID:30556269
Pygm	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of PYGM mRNA	CTD	PMID:30556269
Pygm	Rat	corosolic acid	increases expression	ISO	PYGM (Homo sapiens)	6480464	corosolic acid results in increased expression of PYGM mRNA	CTD	PMID:37939859
Pygm	Rat	daunorubicin	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Daunorubicin results in decreased expression of PYGM mRNA	CTD	PMID:26537877 and PMID:28940058
Pygm	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of PYGM mRNA	CTD	PMID:23640034
Pygm	Rat	decabromodiphenyl ether	decreases expression	ISO	PYGM (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of PYGM protein	CTD	PMID:31675489
Pygm	Rat	dexamethasone	decreases expression	ISO	Pygm (Mus musculus)	6480464	Dexamethasone results in decreased expression of PYGM protein	CTD	PMID:33567340
Pygm	Rat	disodium selenite	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Sodium Selenite results in decreased expression of PYGM mRNA	CTD	PMID:18175754
Pygm	Rat	dorsomorphin	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PYGM mRNA	CTD	PMID:27188386
Pygm	Rat	doxorubicin	increases expression	ISO	Pygm (Mus musculus)	6480464	Doxorubicin results in increased expression of PYGM protein	CTD	PMID:21251210
Pygm	Rat	doxorubicin	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Doxorubicin results in decreased expression of PYGM mRNA	CTD	PMID:26537877 more ...
Pygm	Rat	doxorubicin	multiple interactions	ISO	Pygm (Mus musculus)	6480464	sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of PYGM protein]	CTD	PMID:21251210
Pygm	Rat	endosulfan	increases expression	ISO	PYGM (Homo sapiens)	6480464	Endosulfan results in increased expression of PYGM protein	CTD	PMID:26615145
Pygm	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of PYGM mRNA	CTD	PMID:29391264
Pygm	Rat	ethanol	increases expression	ISO	Pygm (Mus musculus)	6480464	Ethanol results in increased expression of PYGM mRNA	CTD	PMID:30319688
Pygm	Rat	etoposide	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Etoposide results in decreased expression of PYGM mRNA	CTD	PMID:29397400
Pygm	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of PYGM mRNA	CTD	PMID:30307764
Pygm	Rat	genistein	multiple interactions	EXP		6480464	[Genistein co-treated with vinclozolin] results in increased expression of PYGM mRNA	CTD	PMID:23160963
Pygm	Rat	genistein	increases expression	EXP		6480464	Genistein results in increased expression of PYGM mRNA	CTD	PMID:23160963
Pygm	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of PYGM mRNA	CTD	PMID:33387578
Pygm	Rat	haloperidol	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Haloperidol results in decreased expression of PYGM protein	CTD	PMID:34122009
Pygm	Rat	ketamine	increases expression	EXP		6480464	Ketamine results in increased expression of PYGM mRNA	CTD	PMID:20080153
Pygm	Rat	lead diacetate	decreases expression	EXP		6480464	lead acetate results in decreased expression of PYGM protein	CTD	PMID:28916327
Pygm	Rat	Licochalcone B	increases expression	ISO	PYGM (Homo sapiens)	6480464	licochalcone B results in increased expression of PYGM mRNA	CTD	PMID:33647349
Pygm	Rat	mercury dibromide	decreases expression	ISO	PYGM (Homo sapiens)	6480464	mercuric bromide results in decreased expression of PYGM mRNA	CTD	PMID:26272509
Pygm	Rat	mercury dibromide	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PYGM mRNA	CTD	PMID:27188386
Pygm	Rat	mitoxantrone	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Mitoxantrone results in decreased expression of PYGM mRNA	CTD	PMID:26537877 and PMID:28940058
Pygm	Rat	ochratoxin A	increases expression	EXP		6480464	ochratoxin A results in increased expression of PYGM mRNA	CTD	PMID:22124623
Pygm	Rat	ozone	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of PYGM mRNA	CTD	PMID:35430440
Pygm	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of PYGM mRNA	CTD	PMID:32680482
Pygm	Rat	PCB138	decreases expression	EXP		6480464	2 more ...	CTD	PMID:21673325
Pygm	Rat	perfluorohexanesulfonic acid	decreases expression	ISO	PYGM (Homo sapiens)	6480464	perfluorohexanesulfonic acid results in decreased expression of PYGM mRNA	CTD	PMID:25812627
Pygm	Rat	perfluorononanoic acid	decreases expression	ISO	PYGM (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in decreased expression of PYGM mRNA	CTD	PMID:25812627
Pygm	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Pygm (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of PYGM mRNA	CTD	PMID:36331819
Pygm	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	PYGM (Homo sapiens)	6480464	perfluorooctane sulfonic acid results in decreased expression of PYGM mRNA	CTD	PMID:25812627
Pygm	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PYGM mRNA	CTD	PMID:35163327
Pygm	Rat	perfluorooctanoic acid	decreases expression	ISO	PYGM (Homo sapiens)	6480464	perfluorooctanoic acid results in decreased expression of PYGM mRNA	CTD	PMID:25812627
Pygm	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of PYGM mRNA	CTD	PMID:35163327
Pygm	Rat	pioglitazone	multiple interactions	ISO	Pygm (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of PYGM mRNA	CTD	PMID:27935865
Pygm	Rat	potassium chromate	increases expression	ISO	PYGM (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of PYGM mRNA	CTD	PMID:22079256
Pygm	Rat	potassium chromate	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PYGM mRNA	CTD	PMID:22079256
Pygm	Rat	prednisone	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Prednisone results in decreased expression of PYGM protein	CTD	PMID:8815173
Pygm	Rat	progesterone	increases expression	EXP		6480464	Progesterone results in increased expression of PYGM mRNA	CTD	PMID:20726854
Pygm	Rat	SB 431542	multiple interactions	ISO	PYGM (Homo sapiens)	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PYGM mRNA	CTD	PMID:27188386
Pygm	Rat	silicon dioxide	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of PYGM mRNA	CTD	PMID:25895662
Pygm	Rat	silicon dioxide	increases expression	ISO	PYGM (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of PYGM mRNA	CTD	PMID:23806026
Pygm	Rat	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of PYGM protein	CTD	PMID:29459688
Pygm	Rat	sodium arsenite	increases expression	ISO	PYGM (Homo sapiens)	6480464	sodium arsenite results in increased expression of PYGM mRNA	CTD	PMID:38568856
Pygm	Rat	sodium dichromate	increases expression	ISO	PYGM (Homo sapiens)	6480464	sodium bichromate results in increased expression of PYGM mRNA	CTD	PMID:17685462
Pygm	Rat	sodium fluoride	decreases expression	EXP		6480464	Sodium Fluoride results in decreased expression of PYGM protein	CTD	PMID:29653260
Pygm	Rat	sodium nitrate	multiple interactions	ISO	Pygm (Mus musculus)	6480464	sodium nitrate inhibits the reaction [Doxorubicin results in increased expression of PYGM protein]	CTD	PMID:21251210
Pygm	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of PYGM mRNA	CTD	PMID:19281266
Pygm	Rat	streptozocin	multiple interactions	EXP		6480464	Plant Extracts inhibits the reaction [Streptozocin results in decreased activity of PYGM protein] and Polysaccharides inhibits the reaction [Streptozocin results in decreased activity of PYGM protein]	CTD	PMID:26616445
Pygm	Rat	streptozocin	decreases activity	EXP		6480464	Streptozocin results in decreased activity of PYGM protein	CTD	PMID:26616445
Pygm	Rat	sunitinib	decreases expression	ISO	PYGM (Homo sapiens)	6480464	Sunitinib results in decreased expression of PYGM mRNA	CTD	PMID:31533062
Pygm	Rat	tamoxifen	affects expression	ISO	Pygm (Mus musculus)	6480464	Tamoxifen affects the expression of PYGM mRNA	CTD	PMID:17555576
Pygm	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	PYGM (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of PYGM mRNA	CTD	PMID:34925699
Pygm	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PYGM mRNA	CTD	PMID:23411599 and PMID:34492290
Pygm	Rat	thiram	increases expression	ISO	PYGM (Homo sapiens)	6480464	Thiram results in increased expression of PYGM mRNA	CTD	PMID:38568856
Pygm	Rat	titanium dioxide	increases expression	ISO	PYGM (Homo sapiens)	6480464	titanium dioxide results in increased expression of PYGM mRNA	CTD	PMID:34973136
Pygm	Rat	triphenyl phosphate	affects expression	ISO	PYGM (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PYGM mRNA	CTD	PMID:37042841
Pygm	Rat	Triptolide	increases expression	ISO	Pygm (Mus musculus)	6480464	triptolide results in increased expression of PYGM mRNA	CTD	PMID:32835833
Pygm	Rat	triptonide	increases expression	ISO	Pygm (Mus musculus)	6480464	triptonide results in increased expression of PYGM mRNA	CTD	PMID:33045310
Pygm	Rat	urethane	increases expression	ISO	PYGM (Homo sapiens)	6480464	Urethane results in increased expression of PYGM mRNA	CTD	PMID:28818685
Pygm	Rat	valproic acid	increases methylation	ISO	PYGM (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PYGM gene	CTD	PMID:29154799
Pygm	Rat	vinclozolin	multiple interactions	EXP		6480464	[Genistein co-treated with vinclozolin] results in increased expression of PYGM mRNA	CTD	PMID:23160963
Pygm	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of PYGM mRNA	CTD	PMID:23160963
Pygm	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of PYGM mRNA	CTD	PMID:19015723
Pygm	Rat	zinc atom	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of PYGM mRNA	CTD	PMID:19111725
Pygm	Rat	zinc(0)	decreases expression	EXP		6480464	Zinc deficiency results in decreased expression of PYGM mRNA	CTD	PMID:19111725

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	carbohydrate metabolic process	involved_in	IEA	InterPro:IPR000811 and InterPro:IPR011833	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pygm	Rat	glycogen catabolic process		IDA		1599897		RGD
Pygm	Rat	glycogen catabolic process		IDA		1642811		RGD
Pygm	Rat	glycogen catabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9WUB3 and ensembl:ENSMUSP00000047564	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pygm	Rat	glycogen catabolic process	acts_upstream_of_or_within	ISO	Pygm (Mus musculus)	1624291	PMID:15282316 and PMID:17689562	RGD	PMID:15282316 and PMID:17689562
Pygm	Rat	glycogen catabolic process	involved_in	ISO	Pygm (Mus musculus)	1624291	MGI:5696972 PMID:31511858	RGD	PMID:31511858
Pygm	Rat	glycogen catabolic process	involved_in	IBA	CGD:CAL0000189831 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pygm	Rat	glycogen catabolic process	involved_in	IEA	UniProtKB:P11217 and ensembl:ENSP00000164139	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pygm	Rat	glycogen catabolic process	involved_in	IEA	ARBA:ARBA00034181	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Pygm	Rat	glycogen catabolic process	involved_in	ISO	PYGM (Homo sapiens)	1624291	PMID:1150650 and PMID:8316268	RGD	PMID:1150650 and PMID:8316268
Pygm	Rat	glycogen catabolic process		IDA		2304126		RGD
Pygm	Rat	glycogen catabolic process		IDA		1642743		RGD
Pygm	Rat	glycogen catabolic process		IDA		1599986		RGD
Pygm	Rat	glycogen metabolic process		IDA		2304186		RGD
Pygm	Rat	glycogen metabolic process	involved_in	IEA	UniProtKB-KW:KW-0321	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pygm	Rat	glycogen metabolic process		IDA		1642811		RGD
Pygm	Rat	glycogen metabolic process		IDA		2304119		RGD
Pygm	Rat	intracellular calcium ion homeostasis		IDA		1599992		RGD
Pygm	Rat	response to cAMP		IDA		1599988		RGD
Pygm	Rat	response to hypoxia		IDA		1599986		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0004507 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pygm	Rat	sarcoplasmic reticulum		IDA		1599897		RGD
Pygm	Rat	sarcoplasmic reticulum		IDA		1599989		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	1,4-alpha-oligoglucan phosphorylase activity	enables	IEA	InterPro:IPR011833	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pygm	Rat	1,4-alpha-oligoglucan phosphorylase activity	enables	IEA	RHEA:41732	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pygm	Rat	1,4-alpha-oligoglucan phosphorylase activity	enables	IEA	EC:2.4.1.1	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pygm	Rat	AMP binding		IDA		1599986		RGD
Pygm	Rat	carbohydrate binding		IDA		1599986		RGD
Pygm	Rat	carbohydrate binding		IDA		1642811		RGD
Pygm	Rat	carbohydrate binding		IDA		1642743		RGD
Pygm	Rat	catalytic activity	enables	IEA	UniProtKB-KW:KW-0021	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pygm	Rat	glycogen phosphorylase activity		TAS		729794		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		1642811		RGD
Pygm	Rat	glycogen phosphorylase activity	enables	IEA	UniProtKB:Q9WUB3 and ensembl:ENSMUSP00000047564	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pygm	Rat	glycogen phosphorylase activity	enables	IEA	UniProtKB:P11217 and ensembl:ENSP00000164139	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pygm	Rat	glycogen phosphorylase activity	enables	ISO	Pygm (Mus musculus)	1624291	MGI:5696972 PMID:11785984 more ...	RGD	PMID:11785984 more ...
Pygm	Rat	glycogen phosphorylase activity	enables	IBA	CGD:CAL0000189831 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pygm	Rat	glycogen phosphorylase activity	enables	IEA	InterPro:IPR000811	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pygm	Rat	glycogen phosphorylase activity	enables	IEA	ARBA:ARBA00034206	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Pygm	Rat	glycogen phosphorylase activity	enables	ISO	PYGM (Homo sapiens)	1624291	PMID:1150650 and PMID:8316268	RGD	PMID:1150650 and PMID:8316268
Pygm	Rat	glycogen phosphorylase activity		IDA		2304186		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		2304126		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		1642743		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		1599986		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		2304119		RGD
Pygm	Rat	glycogen phosphorylase activity		IDA		1599897		RGD
Pygm	Rat	glycosyltransferase activity	enables	IEA	UniProtKB-KW:KW-0328	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pygm	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pygm	Rat	protein binding	enables	ISO	PYGM (Homo sapiens)	1624291	UniProtKB:O43741 more ...	RGD	PMID:24722188 more ...
Pygm	Rat	pyridoxal phosphate binding		IDA		1599897		RGD
Pygm	Rat	pyridoxal phosphate binding	enables	IBA	FB:FBgn0004507 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pygm	Rat	pyridoxal phosphate binding	enables	IEA	InterPro:IPR011833	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pygm	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	glycogen degradation pathway		ISO	PYGM (Homo sapiens)	2304109		RGD
Pygm	Rat	glycogen degradation pathway		ISO	PYGM (Homo sapiens)	1642822		RGD
Pygm	Rat	glycogen degradation pathway		IDA		1599897		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pygm	Rat	insulin signaling pathway		IEA		6907045		KEGG	rno:04910
Pygm	Rat	starch and sucrose metabolic pathway		IEA		6907045		KEGG	rno:00500

BioCyc Pathways

glycogen degradation II

#	Reference Title	Reference Citation
1.	Development of potent, orally active 1-substituted-3,4-dihydro-2-quinolone glycogen phosphorylase inhibitors.	Birch AM, etal., Bioorg Med Chem Lett. 2007 Jan 15;17(2):394-9. Epub 2006 Oct 19.
2.	Brain-specific regulator of G-protein signaling 9-2 selectively interacts with alpha-actinin-2 to regulate calcium-dependent inactivation of NMDA receptors.	Bouhamdan M, etal., J Neurosci. 2006 Mar 1;26(9):2522-30.
3.	Structural relationships among regulated and unregulated phosphorylases.	Buchbinder JL, etal., Annu Rev Biophys Biomol Struct. 2001;30:191-209.
4.	Epinephrine regulation of skeletal muscle glycogen metabolism. Studies utilizing the perfused rat hindlimb preparation.	Dietz MR, etal., J Biol Chem. 1980 Mar 25;255(6):2301-7.
5.	Effects of electrostimulation on glycogenolysis in cultured rat myotubes.	Elsner P, etal., Pflugers Arch. 2003 Dec;447(3):356-62. Epub 2003 Oct 25.
6.	Alteration of glycogen and glucose metabolism in ischaemic and post-ischaemic working rat hearts by adenosine A1 receptor stimulation.	Fraser H, etal., Br J Pharmacol. 1999 Sep;128(1):197-205.
7.	Regulation of the rat muscle glycogen phosphorylase-encoding gene during muscle cell development.	Froman BE, etal., Gene 1994 Nov 18;149(2):245-52.
8.	The content of glycogen phosphorylase and glycogen in preparations of sarcoplasmic reticulum-glycogenolytic complex is enhanced in diabetic rat skeletal muscle.	Garduno E, etal., Diabetologia. 2001 Oct;44(10):1238-46.
9.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
11.	Botulinum-induced muscle paralysis alters metabolic gene expression and fatigue recovery.	Gorin F, etal., Am J Physiol. 1996 Jan;270(1 Pt 2):R238-45.
12.	Comparative analysis of species-independent, isozyme-specific amino-acid substitutions in mammalian muscle, brain and liver glycogen phosphorylases.	Hudson JW, etal., Biochim Biophys Acta 1993 Jul 10;1164(2):197-208.
13.	Adrenaline-mediated glycogen phosphorylase activation is enhanced in rat soleus muscle with increased glycogen content.	Jensen J, etal., Biochim Biophys Acta. 1999 Oct 18;1472(1-2):215-21.
14.	Glycogen phosphorylase: control by phosphorylation and allosteric effectors.	Johnson LN FASEB J. 1992 Mar;6(6):2274-82.
15.	Differential expression of the regulator of G protein signaling RGS9 protein in nociceptive pathways of different age rats.	Kim KJ, etal., Brain Res Dev Brain Res. 2005 Nov 7;160(1):28-39. Epub 2005 Sep 8.
16.	Molecular diagnosis of McArdle disease: revised genomic structure of the myophosphorylase gene and identification of a novel mutation.	Kubisch C, etal., Hum Mutat. 1998;12(1):27-32.
17.	Hepatic and skeletal muscle glycogen metabolism in rats with short-term cholestasis.	Lang C, etal., J Hepatol. 2002 Jan;36(1):22-9.
18.	Skeletal muscle sarcoplasmic reticulum glycogen status influences Ca2+ uptake supported by endogenously synthesized ATP.	Lees SJ and Williams JH, Am J Physiol Cell Physiol. 2004 Jan;286(1):C97-104. Epub 2003 Sep 10.
19.	Gene expression profile of cardiomyocytes in hypertrophic heart induced by continuous norepinephrine infusion in the rats.	Li P, etal., Cell Mol Life Sci. 2003 Oct;60(10):2200-9.
20.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
21.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.	Ca2+ uptake coupled to glycogen phosphorolysis in the glycogenolytic-sarcoplasmic reticulum complex from rat skeletal muscle.	Nogues M, etal., Z Naturforsch C. 1996 Jul-Aug;51(7-8):591-8.
23.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
24.	Isolation of partial cDNAs for rat liver and muscle glycogen phosphorylase isozymes.	Osawa S, etal., FEBS Lett 1986 Jul 7;202(2):282-8.
25.	Isozyme pattern of glycogen phosphorylase in the rat nervous system and rat astroglia-rich primary cultures: electrophoretic and polymerase chain reaction studies.	Pfeiffer-Guglielmi B, etal., Neurochem Res. 2000 Nov;25(11):1485-91.
26.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
27.	GOA pipeline	RGD automated data pipeline
28.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
30.	Glycogen-binding protein components of rat tissues.	Satoh K and Sato K, Biochem Biophys Res Commun. 1980 Sep 16;96(1):28-33.
31.	Electron microscopical study of a cytosolic enzyme in unfixed cryostat sections: demonstration of glycogen phosphorylase activity in rat liver and heart tissue.	Schellens JP, etal., Histochem J. 1995 Aug;27(8):609-14.
32.	Estrogen modulates RGS9 expression in the nucleus accumbens.	Sharifi JL, etal., Neuroreport. 2004 Oct 25;15(15):2433-6.
33.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
34.	Glycogen metabolism in rat heart muscle cultures after hypoxia.	Vigoda A, etal., Mol Cell Biochem. 2003 Dec;254(1-2):311-8.

PMID:3209063	PMID:3840433	PMID:11596118	PMID:11785984	PMID:12477932	PMID:15282316	PMID:17689562	PMID:21700703	PMID:22206666	PMID:23533145	PMID:23904609	PMID:26945066
PMID:27156240	PMID:30053369	PMID:32357304	PMID:33450132

Pygm
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	213,119,805 - 213,134,622 (+)	NCBI		GRCr8
mRatBN7.2	1	203,690,550 - 203,705,369 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	203,690,533 - 203,705,368 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	212,039,387 - 212,054,202 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	219,135,880 - 219,150,695 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	211,826,933 - 211,841,748 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	221,756,325 - 221,771,142 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	221,756,286 - 221,771,143 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	228,737,461 - 228,758,937 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	209,166,701 - 209,181,588 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	209,325,179 - 209,340,017 (+)	NCBI
Celera	1	201,223,967 - 201,238,784 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

PYGM
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	64,746,389 - 64,760,715 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	64,746,389 - 64,759,974 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	64,513,861 - 64,528,187 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	64,270,606 - 64,284,763 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	64,270,605 - 64,284,763	NCBI
Celera	11	61,840,305 - 61,854,685 (-)	NCBI		Celera
Cytogenetic Map	11	q13.1	NCBI
HuRef	11	60,840,630 - 60,855,032 (-)	NCBI		HuRef
CHM1_1	11	64,397,556 - 64,411,957 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	64,739,618 - 64,754,020 (-)	NCBI		T2T-CHM13v2.0

Pygm
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	6,434,438 - 6,448,494 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	6,434,429 - 6,448,489 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	6,384,408 - 6,398,464 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	6,384,399 - 6,398,459 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	6,384,429 - 6,398,459 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	6,384,429 - 6,398,459 (+)	NCBI		MGSCv36	mm8
Celera	19	6,257,446 - 6,271,476 (+)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	4.53	NCBI

Pygm
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	20,411,480 - 20,424,931 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	20,411,480 - 20,424,676 (+)	NCBI	ChiLan1.0	ChiLan1.0

PYGM
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	65,972,186 - 65,987,376 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	67,015,183 - 67,028,876 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	60,101,810 - 60,115,813 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	63,443,609 - 63,457,012 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	63,443,609 - 63,457,430 (-)	Ensembl	panpan1.1		panPan2

PYGM
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	52,398,192 - 52,410,731 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	52,398,056 - 52,410,464 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	51,005,808 - 51,018,059 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	53,439,715 - 53,451,957 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	53,439,257 - 53,451,957 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	52,534,631 - 52,546,873 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	52,120,553 - 52,132,799 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	52,904,684 - 52,916,934 (+)	NCBI		UU_Cfam_GSD_1.0

Pygm
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	8,108,815 - 8,121,764 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	4,551,032 - 4,564,154 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	4,551,164 - 4,564,109 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PYGM
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	7,409,116 - 7,421,254 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	7,409,330 - 7,421,256 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	6,540,079 - 6,553,856 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PYGM
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	9,474,539 - 9,490,612 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	9,475,622 - 9,491,500 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	106,864,368 - 106,879,692 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pygm
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	21,626,740 - 21,640,161 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	21,626,740 - 21,639,963 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pygm
40 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	163
Count of miRNA genes:	116
Interacting mature miRNAs:	126
Transcripts:	ENSRNOT00000028636
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	199368955	224569684	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1331790	Bp201	Blood pressure QTL 201	3.127		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	198211513	225126682	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat

D1Mgh11

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	1	1537.2	RGD
RH 3.4 Map	1	1537.2	UniSTS
FHH x ACI Map	1	98.97	UniSTS
FHH x ACI Map	1	98.97	RGD
Cytogenetic Map	1	q43	UniSTS

D1Wox28

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	1	1523.1	UniSTS
RH 3.4 Map	1	1523.1	RGD
RH 2.0 Map	1	1152.8	RGD
Cytogenetic Map	1	q43	UniSTS

RH128350

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	203,705,131 - 203,705,337 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	221,770,905 - 221,771,110	NCBI	Rnor6.0
Rnor_5.0	1	228,758,694 - 228,758,899	UniSTS	Rnor5.0
RGSC_v3.4	1	209,181,351 - 209,181,556	UniSTS	RGSC3.4
Celera	1	201,238,547 - 201,238,752	UniSTS
RH 3.4 Map	1	1536.3	UniSTS
Cytogenetic Map	1	q43	UniSTS

RH140670

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	203,696,040 - 203,697,095 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	221,761,816 - 221,762,870	NCBI	Rnor6.0
Rnor_5.0	1	228,749,605 - 228,750,659	UniSTS	Rnor5.0
RGSC_v3.4	1	209,172,192 - 209,173,246	UniSTS	RGSC3.4
Celera	1	201,229,458 - 201,230,512	UniSTS
RH 3.4 Map	1	1537.7	UniSTS
Cytogenetic Map	1	q43	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_012638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC161897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB766603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB803241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK357376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CK358095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR754132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR754647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L10669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L18752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X03032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X04068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028636 ⟹ ENSRNOP00000028636

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	203,690,533 - 203,705,360 (+)	Ensembl
Rnor_6.0 Ensembl	1	221,756,286 - 221,771,143 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094854 ⟹ ENSRNOP00000089298

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	203,690,597 - 203,705,368 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097542 ⟹ ENSRNOP00000085985

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	203,690,533 - 203,705,360 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099163 ⟹ ENSRNOP00000081606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	203,690,533 - 203,704,922 (+)	Ensembl

RefSeq Acc Id:

NM_012638 ⟹ NP_036770

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	213,119,805 - 213,134,622 (+)	NCBI
mRatBN7.2	1	203,690,550 - 203,705,369 (+)	NCBI
Rnor_6.0	1	221,756,325 - 221,771,142 (+)	NCBI
Rnor_5.0	1	228,737,461 - 228,758,937 (+)	NCBI
RGSC_v3.4	1	209,166,701 - 209,181,588 (+)	RGD
Celera	1	201,223,967 - 201,238,784 (+)	RGD

Sequence:

show sequence

GGCACCGAAGCCATCATCTGCCCTGTTCGGCCCACCCTCCCGCAGCCATGTCCAGGCCTCTTTCAGACCAGGATAAGAGAAAGCAAATCAGTGTTCGTGGCCTAGCTGGCGTGGAAAATGTGTCTGAC
CTGAAAAAGAACTTCAACCGCCACCTACATTTCACCCTGGTCAAGGATCGCAATGTGGCCACTCCGAGAGATTACTATTTCGCACTGGCTCACACCGTGCGGGACCACCTCGTGGGACGCTGGATCCG
CACACAGCAGCATTACTACGAAAAGGACCCCAAGAGGATCTACTACCTGTCTTTGGAGTTCTACATGGGGAGGACACTGCAGAACACCATGGTGAACCTGGCCTTGGAGAATGCCTGCGATGAGGCCA
CCTACCAGCTGGGTCTGGACATGGAGGAGCTGGAGGAGATCGAGGAGGATGCAGGGTTGGGCAATGGAGGCCTGGGACGCCTGGCAGCTTGCTTCCTGGACTCCATGGCTACACTGGGGCTAGCTGCC
TATGGCTACGGGATCCGCTATGAGTTTGGGATTTTTAATCAGAAGATCTGTGGGGGCTGGCAGATGGAAGAAGCTGATGACTGGCTTCGCTATGGCAACCCCTGGGAGAAGGCCCGCCCAGAGTTCAC
GCTGCCTGTGCACTTCTACGGTCGAGTGGAGCACACCAGTCAGGGTGCCAAGTGGGTGGACACACAGGTAGTGTTGGCTATGCCCTATGACACTCCTGTGCCTGGCTATCGAAACAACGTTGTCAACA
CCATGCGCCTCTGGTCGGCCAAGGCACCTAATGACTTCAACCTCAAGGACTTCAACGTTGGCGGCTACATCCAGGCCGTGCTGGACCGAAACCTGGCTGAGAACATCTCACGTGTTTTGTACCCCAAT
GATAACTTCTTTGAAGGGAAGGAATTGCGGCTGAAGCAGGAGTACTTTGTGGTGGCCGCCACCCTCCAGGACATCATTCGCCGTTTCAAGTCCTCCAAGTTTGGCTGCCGTGATCCTGTGCGCACAAA
CTTTGATGCTTTCCCTGATAAGGTGGCCATCCAGCTCAACGACACCCACCCTTCTTTGGCCATCCCTGAACTGATGAGGATTCTGGTGGACCTGGAACGACTGGACTGGGACAAGGCCTGGGATGTGA
CAGTGAAGACCTGTGCCTACACCAACCACACAGTGCTGCCTGAAGCCCTGGAGCGCTGGCCAGTGCACCTCATGGAGACACTGCTTCCCCGCCATCTGCAGATCATTTATGAGATCAACCAGCGTTTC
CTTAATCGGGTGGCGGCCGCATTCCCTGGGGACGTAGATAGGCTGCGGCGCATGTCACTCGTGGAGGAAGGAGCGGTGAAACGCATCAACATGGCACACTTGTGCATTGCTGGTTCCCACGCAGTCAA
CGGTGTGGCTCGCATCCATTCGGAGATCCTCAAGAAAACCATCTTCAAGGACTTTTATGAGCTGGAGCCTCACAAGTTCCAGAACAAGACCAATGGCATCACCCCTCGGCGCTGGTTGGTTCTGTGTA
ACCCTGGGCTGGCAGAGGTCATTGCTGAGCGCATCGGTGAGGAGTACATCTCGGATCTGGACCAGCTACGCAAGCTGCTCTCCTATGTGGATGATGAAGCCTTTATCCGTGATGTGGCCAAAGTGAAA
CAGGAAAACAAGTTGAAATTCTCTGCGTACCTGGAGAGGGAATACAAAGTCCACATCAACCCCAACTCCCTCTTCGACGTCCAGGTGAAGAGGATTCATGAGTATAAACGCCAGCTTCTCAATTGCCT
TCACATCATCACCTTGTATAACCGCATCAAAAGGGAGCCCAATAGGTTCATGGTGCCAAGGACTATCATGATTGGAGGCAAGGCTGCACCCGGGTACCACATGGCTAAGATGATCATCAAGCTTATCA
CCGCCATTGGGGATGTGGTCAACCACGACCCTGCGGTGGGAGACCGCCTCCGAGTGATCTTCCTGGAGAACTACCGAGTCTCACTGGCTGAGAAAGTTATTCCCGCTGCTGACCTCTCAGAGCAGATC
TCCACCGCGGGCACTGAGGCCTCAGGCACTGGCAACATGAAGTTCATGCTCAACGGGGCTCTGACCATCGGCACCATGGATGGTGCCAACGTGGAGATGGCAGAGGAGGCTGGGGAAGATAACTTCTT
CATCTTCGGCATGCGGGTGGAGGACGTGGAAAGGCTGGACCAGAGAGGGTACAATGCCCAGGAATACTACGACCGGATTCCTGAGCTTCGGCAGATCATCGAACAGTTAAGCAGTGGCTTCTTCTCCC
CTAAACAGCCTGACCTGTTCAAGGACATCGTCAACATGCTCATGCACCATGACCGGTTTAAAGTCTTTGCAGATTATGAGGAATACATTAAATGCCAGGACAAAGTCAGTGAGTTGTACAAGAACCCA
AGAGAGTGGACACGGATGGTGATCAGGAACATAGCCACCTCTGGCAAGTTTTCCAGTGACCGTACCATTGCCCAGTATGCCCGGGAGATCTGGGGTGTTGAACCTTCTCGTCAGCGCCTGCCAGCCCC
AGATGAGAAGATCTGAGCTTCCACACCAGACCCCATACCTGCCTTTGAGTCTGTTTGCAATTCCCGGAATCAGGCCCACTCCAGGGGTTGGGCCCCTGGAATTACATCTCTACCCTCCCCCTTTTGGA
AGCCTCTTTTACCAGTCTCTAGGTCCTGATGCCAGTGTGACTAAAGACCCTGCCCTCTTCTTTTCCCTCAACTCCCTACCCCCTTTATTTATGTATGGGGTCTAACCAAGTGCACCCACTCCCCAATA
AATCGACTCTCCATGACCTTCCTTAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_036770	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41253	(Get FASTA)	NCBI Sequence Viewer
	AAA62613	(Get FASTA)	NCBI Sequence Viewer
	AAI61897	(Get FASTA)	NCBI Sequence Viewer
	CAA26835	(Get FASTA)	NCBI Sequence Viewer
	EDM12601	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028636
GenBank Protein	P09812	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036770 ⟸ NM_012638

- UniProtKB:

G3V8V3 (UniProtKB/TrEMBL), A6HZH0 (UniProtKB/TrEMBL), B1WBU9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRPLSDQDKRKQISVRGLAGVENVSDLKKNFNRHLHFTLVKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDMEELEEIEE
DAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLK
DFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERLDWDKAWDVTVKTCAYTNHTVLPEA
LERWPVHLMETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEEY
ISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFSAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHIITLYNRIKREPNRFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPAVGDR
LRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEDNFFIFGMRVEDVERLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNMLMH
HDRFKVFADYEEYIKCQDKVSELYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEKI

hide sequence

Ensembl Acc Id:

ENSRNOP00000028636 ⟸ ENSRNOT00000028636

Ensembl Acc Id:

ENSRNOP00000081606 ⟸ ENSRNOT00000099163

Ensembl Acc Id:

ENSRNOP00000085985 ⟸ ENSRNOT00000097542

Ensembl Acc Id:

ENSRNOP00000089298 ⟸ ENSRNOT00000094854

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P09812-F1-model_v2	AlphaFold	P09812	1-842	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13690701

Promoter ID:

EPDNEW_R1224

Type:

single initiation site

Name:

Pygm_1

Description:

glycogen phosphorylase, muscle associated

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	221,756,235 - 221,756,295	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-56595	BioCyc
BioCyc Pathway	PWY-5941 [glycogen degradation II]	BioCyc
BioCyc Pathway Image	PWY-5941	BioCyc
Ensembl Genes	ENSRNOG00000021090	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000028636	ENTREZGENE
Gene3D-CATH	Glycogen Phosphorylase B	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8366912	IMAGE-MGC_LOAD
InterPro	Glycg_phsphrylas	UniProtKB/Swiss-Prot
	Glyco_trans_35	UniProtKB/Swiss-Prot
	Pyridoxal_P_attach_site	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187616	IMAGE-MGC_LOAD
NCBI Gene	24701	ENTREZGENE
PANTHER	GLYCOGEN PHOSPHORYLASE, MUSCLE FORM	UniProtKB/Swiss-Prot
	PTHR11468	UniProtKB/Swiss-Prot
Pfam	Phosphorylase	UniProtKB/Swiss-Prot
PhenoGen	Pygm	PhenoGen
PIRSF	Pprylas_GlgP	UniProtKB/Swiss-Prot
PROSITE	PHOSPHORYLASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000021090	RatGTEx
Superfamily-SCOP	UDP-Glycosyltransferase/glycogen phosphorylase	UniProtKB/Swiss-Prot
TIGR	TC204701
UniProt	A0A8I6A2T3_RAT	UniProtKB/TrEMBL
	A0A8I6A9J1_RAT	UniProtKB/TrEMBL
	A0A8I6G867_RAT	UniProtKB/TrEMBL
	A6HZH0	ENTREZGENE, UniProtKB/TrEMBL
	B1WBU9	ENTREZGENE, UniProtKB/TrEMBL
	G3V8V3	ENTREZGENE, UniProtKB/TrEMBL
	P09812	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-11-18	Pygm	glycogen phosphorylase, muscle associated	Pygm	phosphorylase, glycogen, muscle	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-30	Pygm	phosphorylase, glycogen, muscle	Pygm	muscle glycogen phosphorylase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pygm	Phosphorylase, glycogen; muscle (McArdle syndrome)			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

BioCyc Pathways