Symbol:
Ptgis
Name:
prostaglandin I2 synthase
RGD ID:
3438
Description:
Enables prostaglandin-I synthase activity. Involved in several processes, including cellular response to estradiol stimulus; negative regulation of smooth muscle cell proliferation; and prostaglandin biosynthetic process. Predicted to be located in caveola; endoplasmic reticulum membrane; and nucleus. Used to study cerebral infarction; congestive heart failure; ischemia (multiple); and pulmonary hypertension. Biomarker of hypertension. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); colorectal adenoma; limb ischemia; and primary pulmonary hypertension. Orthologous to human PTGIS (prostaglandin I2 synthase); PARTICIPATES IN prostacyclin biosynthetic pathway; acetylsalicylic acid pharmacodynamics pathway; antipyrine drug pathway; INTERACTS WITH (R)-carnitine; 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
hydroperoxy icosatetraenoate dehydratase; PGIS; prostacyclin synthase; prostaglandin I2 (prostacyclin) synthase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 176,347,589 - 176,383,251 (-) NCBI GRCr8 mRatBN7.2 3 155,928,564 - 155,964,228 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 155,916,412 - 155,965,451 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 159,730,001 - 159,765,702 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,228,974 - 168,264,675 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 165,970,684 - 166,006,385 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 163,950,746 - 163,986,129 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 3 170,109,317 - 170,143,882 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 158,356,878 - 158,387,984 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,262,914 - 158,294,020 (-) NCBI Celera 3 154,508,773 - 154,544,997 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ptgis Rat (R)-carnitine increases response to substance EXP 6480464 PTGIS protein results in increased susceptibility to Carnitine CTD PMID:19491382 Ptgis Rat (R)-carnitine multiple interactions EXP 6480464 [Carnitine results in increased expression of PTGIS mRNA] which results in increased chemical synthesis of 6-Ketoprostaglandin F1 alpha CTD PMID:19491382 Ptgis Rat (R)-carnitine increases expression EXP 6480464 Carnitine results in increased expression of PTGIS mRNA CTD PMID:19491382 Ptgis Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Ptgis Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PTGIS mRNA CTD PMID:12075121 Ptgis Rat 17alpha-ethynylestradiol multiple interactions ISO Ptgis (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PTGIS mRNA CTD PMID:37844793 Ptgis Rat 17beta-estradiol increases expression ISO Ptgis (Mus musculus) 6480464 Estradiol results in increased expression of PTGIS mRNA CTD PMID:19484750 Ptgis Rat 17beta-estradiol increases expression EXP 401960078 17beta-estradiol increases expression of Ptgis protein in cerebral blood vessels RGD Ptgis Rat 17beta-estradiol decreases expression ISO Ptgis (Mus musculus) 6480464 Estradiol results in decreased expression of PTGIS mRNA CTD PMID:39298647 Ptgis Rat 17beta-estradiol decreases expression EXP 401960094 Beta-estradiol decreases expression of Ptgis protein in aortic endothelial cells RGD Ptgis Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ptgis (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ptgis (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTGIS mRNA CTD PMID:15591033 Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGIS mRNA CTD PMID:34747641 Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ptgis (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PTGIS mRNA CTD PMID:28213091 Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PTGIS mRNA CTD PMID:11752688 more ... Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ptgis (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PTGIS mRNA CTD PMID:21570461 Ptgis Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PTGIS mRNA CTD PMID:22298810 Ptgis Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Ptgis Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PTGIS mRNA CTD PMID:25526689 Ptgis Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ptgis (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ptgis Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PTGIS mRNA CTD PMID:21346803 Ptgis Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ptgis (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PTGIS mRNA CTD PMID:16054899 Ptgis Rat 4,4'-sulfonyldiphenol increases expression ISO Ptgis (Mus musculus) 6480464 bisphenol S results in increased expression of PTGIS mRNA CTD PMID:30951980 Ptgis Rat 6-oxoprostaglandin F1alpha multiple interactions EXP 6480464 [Carnitine results in increased expression of PTGIS mRNA] which results in increased chemical synthesis of 6-Ketoprostaglandin F1 alpha CTD PMID:19491382 Ptgis Rat 6-oxoprostaglandin F1alpha increases chemical synthesis EXP 6480464 PTGIS protein results in increased chemical synthesis of 6-Ketoprostaglandin F1 alpha CTD PMID:19491382 Ptgis Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PTGIS mRNA CTD PMID:24780913 Ptgis Rat 7-nitroindazole EXP 401960086 7-nitroindazole decreases Ptgis mRNA in cerebral cortex RGD Ptgis Rat acrolein decreases expression ISO PTGIS (Homo sapiens) 6480464 Acrolein results in decreased expression of PTGIS mRNA and Acrolein results in decreased expression of PTGIS protein CTD PMID:17255567 Ptgis Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PTGIS mRNA CTD PMID:28959563 Ptgis Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PTGIS mRNA CTD PMID:23630614 Ptgis Rat all-trans-retinoic acid decreases expression ISO PTGIS (Homo sapiens) 6480464 Tretinoin results in decreased expression of PTGIS mRNA CTD PMID:21934132 Ptgis Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PTGIS mRNA CTD PMID:20488242 Ptgis Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PTGIS mRNA CTD PMID:16483693 Ptgis Rat Ammothamnine increases expression EXP 401960097 Oxymatrine increases expression of Ptgis protein in the heart left ventricle RGD Ptgis Rat antirheumatic drug increases expression ISO PTGIS (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PTGIS mRNA CTD PMID:24449571 Ptgis Rat aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of PTGIS mRNA CTD PMID:36863539 Ptgis Rat arsane multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat arsenic atom multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat arsenite(3-) increases expression ISO Ptgis (Mus musculus) 6480464 arsenite results in increased expression of PTGIS protein CTD PMID:37955338 Ptgis Rat asbestos decreases expression ISO PTGIS (Homo sapiens) 6480464 Asbestos results in decreased expression of PTGIS mRNA CTD PMID:22398240 Ptgis Rat Azoxymethane multiple interactions ISO Ptgis (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIS mRNA CTD PMID:29950665 Ptgis Rat benzene decreases expression ISO Ptgis (Mus musculus) 6480464 Benzene results in decreased expression of PTGIS mRNA CTD PMID:37084897 Ptgis Rat benzo[a]pyrene increases expression ISO Ptgis (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PTGIS mRNA CTD PMID:22228805 Ptgis Rat benzo[a]pyrene increases methylation ISO PTGIS (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PTGIS 3' UTR CTD PMID:27901495 Ptgis Rat benzo[a]pyrene affects methylation ISO PTGIS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PTGIS promoter CTD PMID:27901495 Ptgis Rat benzo[a]pyrene affects expression ISO Ptgis (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of PTGIS mRNA CTD PMID:22342234 Ptgis Rat benzo[a]pyrene diol epoxide I affects expression ISO PTGIS (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Ptgis Rat bis(2-chloroethyl) sulfide increases expression ISO Ptgis (Mus musculus) 6480464 Mustard Gas results in increased expression of PTGIS mRNA CTD PMID:15674843 Ptgis Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ptgis (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PTGIS mRNA CTD PMID:34319233 Ptgis Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PTGIS mRNA CTD PMID:12075121 Ptgis Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PTGIS mRNA CTD PMID:25181051 more ... Ptgis Rat bisphenol A decreases expression ISO PTGIS (Homo sapiens) 6480464 bisphenol A results in decreased expression of PTGIS mRNA CTD PMID:31715268 Ptgis Rat bisphenol AF increases expression ISO PTGIS (Homo sapiens) 6480464 bisphenol AF results in increased expression of PTGIS protein CTD PMID:34186270 Ptgis Rat Bisphenol B increases expression ISO PTGIS (Homo sapiens) 6480464 bisphenol B results in increased expression of PTGIS protein CTD PMID:34186270 Ptgis Rat bisphenol F increases expression ISO PTGIS (Homo sapiens) 6480464 bisphenol F results in increased expression of PTGIS protein CTD PMID:34186270 Ptgis Rat bosentan multiple interactions EXP 401901264 Bosentan inhibits the reaction [Monocrotaline increases expression of Ptgis mRNA in lung] RGD Ptgis Rat cadmium dichloride increases expression ISO Ptgis (Mus musculus) 6480464 Cadmium Chloride results in increased expression of PTGIS mRNA CTD PMID:24982889 Ptgis Rat calcitriol decreases expression ISO PTGIS (Homo sapiens) 6480464 Calcitriol results in decreased expression of PTGIS mRNA CTD PMID:26485663 Ptgis Rat candesartan decreases expression EXP 6480464 candesartan results in decreased expression of PTGIS mRNA CTD PMID:14871019 Ptgis Rat cantharidin decreases expression ISO Ptgis (Mus musculus) 6480464 Cantharidin results in decreased expression of PTGIS mRNA CTD PMID:36907384 Ptgis Rat carbon nanotube decreases expression ISO Ptgis (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of PTGIS mRNA CTD PMID:25554681 and PMID:25620056 Ptgis Rat carboxy-PTIO decreases activity EXP 401960074 cPTIO decreases activity of Ptgis protein in the aorta RGD Ptgis Rat CGP 52608 multiple interactions ISO PTGIS (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PTGIS gene] CTD PMID:28238834 Ptgis Rat clofibrate decreases expression ISO Ptgis (Mus musculus) 6480464 Clofibrate results in decreased expression of PTGIS mRNA CTD PMID:17585979 Ptgis Rat dexamethasone multiple interactions ISO Ptgis (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PTGIS mRNA CTD PMID:16054899 Ptgis Rat dextran sulfate multiple interactions ISO Ptgis (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIS mRNA CTD PMID:29950665 Ptgis Rat diatomic oxygen increases expression EXP 401959327 Hypoxia increases expression of Ptgis mRNA in the lung RGD Ptgis Rat dibenz[a,h]anthracene increases expression ISO Ptgis (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ptgis Rat diclofenac multiple interactions ISO Ptgis (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PTGIS mRNA CTD PMID:37844793 Ptgis Rat diethyl malate affects expression ISO Ptgis (Mus musculus) 6480464 diethyl malate affects the expression of PTGIS mRNA CTD PMID:24814887 Ptgis Rat dioxygen increases expression ISO PTGIS (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PTGIS mRNA CTD PMID:26516004 Ptgis Rat disodium selenite affects expression ISO Ptgis (Mus musculus) 6480464 Sodium Selenite affects the expression of PTGIS mRNA CTD PMID:21669866 Ptgis Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PTGIS mRNA CTD PMID:25152437 Ptgis Rat dorsomorphin multiple interactions ISO PTGIS (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgis Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of PTGIS protein CTD PMID:28818578 Ptgis Rat entinostat decreases expression ISO PTGIS (Homo sapiens) 6480464 entinostat results in decreased expression of PTGIS mRNA CTD PMID:26272509 Ptgis Rat entinostat multiple interactions ISO PTGIS (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTGIS mRNA CTD PMID:27188386 Ptgis Rat entinostat increases expression ISO PTGIS (Homo sapiens) 6480464 entinostat results in increased expression of PTGIS mRNA CTD PMID:27188386 Ptgis Rat ethanol multiple interactions ISO Ptgis (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PTGIS mRNA CTD PMID:30517762 Ptgis Rat fluvastatin increases expression ISO PTGIS (Homo sapiens) 401901154 Fluvastatin increases expression of PTGIS mRNA in umbilical vein endothelial cells RGD Ptgis Rat furan increases expression EXP 6480464 furan results in increased expression of PTGIS mRNA CTD PMID:27387713 Ptgis Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PTGIS mRNA CTD PMID:12075121 Ptgis Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PTGIS mRNA CTD PMID:19491382 Ptgis Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of PTGIS mRNA CTD PMID:24136188 Ptgis Rat glucose decreases activity ISO PTGIS (Homo sapiens) 401960102 Glucose decreases activity of PTGIS protein in aortic endothelial cells RGD Ptgis Rat ibuprofen multiple interactions ISO Ptgis (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of PTGIS mRNA CTD PMID:37844793 Ptgis Rat inulin multiple interactions ISO Ptgis (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PTGIS mRNA CTD PMID:36331819 Ptgis Rat Lasiocarpine decreases expression ISO PTGIS (Homo sapiens) 6480464 lasiocarpine metabolite results in decreased expression of PTGIS mRNA and lasiocarpine metabolite results in decreased expression of PTGIS protein CTD PMID:30465738 Ptgis Rat Lasiocarpine decreases expression ISO PTGIS (Homo sapiens) 401959398 [Lasiocarpine cotreated with liver homogenate supernatant] decreases expression of PTGIS mRNA in vascular endothelial cells RGD Ptgis Rat manganese atom multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat manganese(0) multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat manganese(II) chloride multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat methamphetamine decreases expression ISO Ptgis (Mus musculus) 6480464 Methamphetamine results in decreased expression of PTGIS mRNA CTD PMID:36914120 Ptgis Rat methotrexate decreases expression ISO PTGIS (Homo sapiens) 6480464 Methotrexate results in decreased expression of PTGIS mRNA CTD PMID:17400583 Ptgis Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PTGIS gene CTD PMID:35440735 Ptgis Rat molsidomine multiple interactions EXP 401959327 Molsidomine inhibits the reaction [Hypoxia increases expression of Ptgis mRNA in the lung] RGD Ptgis Rat monocrotaline increases expression EXP 401901264 Monocrotaline increases expression of Ptgis mRNA in lung RGD Ptgis Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PTGIS mRNA CTD PMID:28801915 Ptgis Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of PTGIS mRNA CTD PMID:33484710 Ptgis Rat oxidised LDL decreases expression ISO PTGIS (Homo sapiens) 401959395 Oxidized LDL decreases expression of PTGIS mRNA in aortic endothelial cells and aortic smooth muscle cells RGD Ptgis Rat ozone multiple interactions ISO Ptgis (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PTGIS mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PTGIS mRNA CTD PMID:34911549 Ptgis Rat paracetamol affects expression ISO Ptgis (Mus musculus) 6480464 Acetaminophen affects the expression of PTGIS mRNA CTD PMID:17562736 Ptgis Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PTGIS mRNA CTD PMID:32680482 Ptgis Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PTGIS mRNA CTD PMID:18692542 Ptgis Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ptgis (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PTGIS mRNA CTD PMID:36331819 Ptgis Rat perfluorooctane-1-sulfonic acid increases expression EXP 6480464 perfluorooctane sulfonic acid results in increased expression of PTGIS mRNA CTD PMID:22237054 Ptgis Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PTGIS mRNA CTD PMID:19162173 Ptgis Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of PTGIS mRNA CTD PMID:18158353 Ptgis Rat phenylmercury acetate decreases expression ISO PTGIS (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PTGIS mRNA CTD PMID:26272509 Ptgis Rat phenylmercury acetate multiple interactions ISO PTGIS (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTGIS mRNA CTD PMID:27188386 Ptgis Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PTGIS mRNA CTD PMID:19162173 Ptgis Rat propanal increases expression ISO PTGIS (Homo sapiens) 6480464 propionaldehyde results in increased expression of PTGIS mRNA CTD PMID:17255567 Ptgis Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of PTGIS mRNA CTD PMID:16079270 Ptgis Rat resveratrol multiple interactions ISO PTGIS (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of PTGIS mRNA CTD PMID:23557933 Ptgis Rat rofecoxib decreases expression ISO PTGIS (Homo sapiens) 6480464 rofecoxib results in decreased expression of PTGIS mRNA CTD PMID:17175104 Ptgis Rat SB 431542 multiple interactions ISO PTGIS (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ptgis Rat senecionine decreases expression ISO PTGIS (Homo sapiens) 6480464 senecionine metabolite results in decreased expression of PTGIS mRNA and senecionine metabolite results in decreased expression of PTGIS protein CTD PMID:30465738 Ptgis Rat Senkirkine decreases expression ISO PTGIS (Homo sapiens) 6480464 senkirkine metabolite results in decreased expression of PTGIS mRNA CTD PMID:30465738 Ptgis Rat sodium arsenite decreases expression ISO Ptgis (Mus musculus) 6480464 sodium arsenite results in decreased expression of PTGIS mRNA CTD PMID:20965206 Ptgis Rat sodium arsenite multiple interactions ISO PTGIS (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PTGIS mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PTGIS mRNA CTD PMID:39836092 Ptgis Rat sodium arsenite decreases expression ISO PTGIS (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PTGIS mRNA CTD PMID:34032870 Ptgis Rat sodium arsenite increases expression ISO Ptgis (Mus musculus) 6480464 sodium arsenite results in increased expression of PTGIS protein CTD PMID:29044176 Ptgis Rat sodium chloride multiple interactions EXP 6480464 [AGT protein co-treated with Sodium Chloride] affects the expression of PTGIS mRNA CTD PMID:27225954 Ptgis Rat sodium fluoride increases expression ISO Ptgis (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PTGIS protein CTD PMID:28918527 Ptgis Rat T-2 toxin decreases expression ISO PTGIS (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of PTGIS mRNA CTD PMID:31863870 Ptgis Rat tetrachloromethane affects expression ISO Ptgis (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PTGIS mRNA CTD PMID:17484886 Ptgis Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PTGIS mRNA CTD PMID:30723492 Ptgis Rat tetrachloromethane multiple interactions ISO Ptgis (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PTGIS mRNA CTD PMID:30517762 Ptgis Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PTGIS mRNA CTD PMID:16644059 Ptgis Rat titanium dioxide decreases expression ISO Ptgis (Mus musculus) 6480464 titanium dioxide results in decreased expression of PTGIS mRNA CTD PMID:23557971 Ptgis Rat titanium dioxide decreases methylation ISO Ptgis (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PTGIS gene and titanium dioxide results in decreased methylation of PTGIS promoter CTD PMID:35295148 Ptgis Rat titanium dioxide multiple interactions ISO Ptgis (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PTGIS mRNA CTD PMID:29950665 Ptgis Rat titanium dioxide increases expression ISO Ptgis (Mus musculus) 6480464 titanium dioxide results in increased expression of PTGIS mRNA CTD PMID:27760801 Ptgis Rat tricetin decreases expression ISO PTGIS (Homo sapiens) 6480464 tricetin results in decreased expression of PTGIS mRNA CTD PMID:38654487 Ptgis Rat triglyceride decreases activity EXP 401960098 Triglyceride decreases activity of Ptgis protein in the aorta RGD Ptgis Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of PTGIS mRNA CTD PMID:24136188 Ptgis Rat valproic acid affects expression ISO Ptgis (Mus musculus) 6480464 Valproic Acid affects the expression of PTGIS mRNA CTD PMID:17292431 Ptgis Rat valproic acid multiple interactions ISO PTGIS (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PTGIS mRNA CTD PMID:27188386 Ptgis Rat valproic acid decreases expression ISO PTGIS (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PTGIS mRNA CTD PMID:23179753 more ... Ptgis Rat valproic acid affects expression ISO PTGIS (Homo sapiens) 6480464 Valproic Acid affects the expression of PTGIS mRNA CTD PMID:25979313 Ptgis Rat valproic acid increases methylation ISO PTGIS (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PTGIS gene CTD PMID:29154799 Ptgis Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PTGIS mRNA CTD PMID:23034163
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(R)-carnitine (EXP) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-trinitrobenzenesulfonic acid (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-oxoprostaglandin F1alpha (EXP) 6-propyl-2-thiouracil (EXP) 7-nitroindazole (EXP) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) ammonium chloride (EXP) Ammothamnine (EXP) antirheumatic drug (ISO) aristolochic acid A (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) asbestos (ISO) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bosentan (EXP) cadmium dichloride (ISO) calcitriol (ISO) candesartan (EXP) cantharidin (ISO) carbon nanotube (ISO) carboxy-PTIO (EXP) CGP 52608 (ISO) clofibrate (ISO) dexamethasone (ISO) dextran sulfate (ISO) diatomic oxygen (EXP) dibenz[a,h]anthracene (ISO) diclofenac (ISO) diethyl malate (ISO) dioxygen (ISO) disodium selenite (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP) entinostat (ISO) ethanol (ISO) fluvastatin (ISO) furan (EXP) genistein (EXP) gentamycin (EXP) glafenine (EXP) glucose (ISO) ibuprofen (ISO) inulin (ISO) Lasiocarpine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methotrexate (ISO) methoxychlor (EXP) molsidomine (EXP) monocrotaline (EXP) N-methyl-4-phenylpyridinium (EXP) nitrofen (EXP) oxidised LDL (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) phenobarbital (EXP) phenylephrine (EXP) phenylmercury acetate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propanal (ISO) raloxifene (EXP) resveratrol (ISO) rofecoxib (ISO) SB 431542 (ISO) senecionine (ISO) Senkirkine (ISO) sodium arsenite (ISO) sodium chloride (EXP) sodium fluoride (ISO) T-2 toxin (ISO) tetrachloromethane (EXP,ISO) titanium dioxide (ISO) tricetin (ISO) triglyceride (EXP) valdecoxib (EXP) valproic acid (ISO) vinclozolin (EXP)
Biological Process
apoptotic signaling pathway (IEA,ISO) cellular response to estradiol stimulus (IEP) cellular response to hypoxia (IEA,IMP,ISO,ISS) cellular response to interleukin-1 (IEA,ISO,ISS) cellular response to interleukin-6 (IEA,ISO,ISS) cellular response to tumor necrosis factor (IEP) cyclooxygenase pathway (ISO) decidualization (IEA,ISO) embryo implantation (IEA,ISO) fatty acid biosynthetic process (IEA) fatty acid metabolic process (IEA) icosanoid metabolic process (IEA,ISO) lipid metabolic process (IEA) negative regulation of cell population proliferation (IMP) negative regulation of inflammatory response (IEA,ISO,ISS) negative regulation of nitric oxide biosynthetic process (IEA,ISO,ISS) negative regulation of protein phosphorylation (IMP) negative regulation of smooth muscle cell proliferation (IMP) positive regulation of angiogenesis (IEA,ISO,ISS) positive regulation of execution phase of apoptosis (IEA,ISO,ISS) positive regulation of gene expression (IMP) positive regulation of peroxisome proliferator activated receptor signaling pathway (IEA,ISO,ISS) prostaglandin biosynthetic process (IBA,IDA,IEA,IMP,ISO,ISS) prostaglandin metabolic process (IEA,ISO) response to alkaloid (IEP) response to estradiol (IEP) response to hypoxia (IEP,IMP) vasodilation (ISO)
1.
Increased pulmonary prostacyclin synthesis in rats with chronic hypoxic pulmonary hypertension.
Blumberg FC, etal., Cardiovasc Res. 2002 Jul;55(1):171-7. doi: 10.1016/s0008-6363(02)00318-8.
2.
Endothelial prostacyclin protects the kidney from ischemia-reperfusion injury.
Cao Y, etal., Pflugers Arch. 2019 Apr;471(4):543-555. doi: 10.1007/s00424-018-2229-6. Epub 2018 Nov 9.
3.
Cytochrome P450 and matrix metalloproteinase genetic modifiers of disease severity in Cerebral Cavernous Malformation type 1.
Choquet H, etal., Free Radic Biol Med. 2016 Mar;92:100-109. doi: 10.1016/j.freeradbiomed.2016.01.008. Epub 2016 Jan 19.
4.
Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
Dagle JM, etal., Pediatrics. 2009 Apr;123(4):1116-23. doi: 10.1542/peds.2008-0313.
5.
Altered expression of inflammation-related genes in human carotid atherosclerotic plaques.
Di Taranto MD, etal., Atherosclerosis. 2012 Jan;220(1):93-101. doi: 10.1016/j.atherosclerosis.2011.10.022. Epub 2011 Oct 25.
6.
Insulin resistance reduces arterial prostacyclin synthase and eNOS activities by increasing endothelial fatty acid oxidation.
Du X, etal., J Clin Invest. 2006 Apr;116(4):1071-80. doi: 10.1172/JCI23354. Epub 2006 Mar 9.
7.
Pyrrolizidine alkaloid-induced alterations of prostanoid synthesis in human endothelial cells.
Ebmeyer J, etal., Chem Biol Interact. 2019 Jan 25;298:104-111. doi: 10.1016/j.cbi.2018.11.007. Epub 2018 Nov 19.
8.
Induction of prostacyclin/PGI2 synthase expression after cerebral ischemia-reperfusion.
Fang YC, etal., J Cereb Blood Flow Metab. 2006 Apr;26(4):491-501.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Pulmonary prostacyclin synthase overexpression in transgenic mice protects against development of hypoxic pulmonary hypertension.
Geraci MW, etal., J Clin Invest 1999 Jun;103(11):1509-15.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Prostacyclin synthase gene transfer inhibits neointimal formation in rat balloon-injured arteries without bleeding complications.
Harada M, etal., Cardiovasc Res. 1999 Aug 1;43(2):481-91. doi: 10.1016/s0008-6363(99)00107-8.
13.
Enhanced therapeutic angiogenesis by cotransfection of prostacyclin synthase gene or optimization of intramuscular injection of naked plasmid DNA.
Hiraoka K, etal., Circulation. 2003 Nov 25;108(21):2689-96. doi: 10.1161/01.CIR.0000093275.78676.F4. Epub 2003 Oct 20.
14.
Prostacyclin synthase gene transfer inhibits neointimal formation by suppressing PPAR delta expression.
Imai H, etal., Atherosclerosis. 2007 Dec;195(2):322-32. doi: 10.1016/j.atherosclerosis.2007.01.010. Epub 2007 Feb 14.
15.
Mesenchymal stem cell-based gene therapy with prostacyclin synthase enhanced neovascularization in hindlimb ischemia.
Ishii M, etal., Atherosclerosis. 2009 Sep;206(1):109-18. doi: 10.1016/j.atherosclerosis.2009.02.023. Epub 2009 Mar 11.
16.
Adenoassociated virus-mediated prostacyclin synthase expression prevents pulmonary arterial hypertension in rats.
Ito T, etal., Hypertension. 2007 Sep;50(3):531-6. doi: 10.1161/HYPERTENSIONAHA.107.091348. Epub 2007 Jul 16.
17.
Effects of IL-1beta, TNF-alpha, and macrophage migration inhibitory factor on prostacyclin synthesis in rat pulmonary artery smooth muscle cells.
Itoh A, etal., Respirology. 2003 Dec;8(4):467-72. doi: 10.1046/j.1440-1843.2003.00491.x.
18.
Human prostacyclin synthase gene and hypertension : the Suita Study.
Iwai N, etal., Circulation. 1999 Nov 30;100(22):2231-6. doi: 10.1161/01.cir.100.22.2231.
19.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
20.
Enhanced angiogenesis and improvement of neuropathy by cotransfection of human hepatocyte growth factor and prostacyclin synthase gene.
Koike H, etal., FASEB J. 2003 Apr;17(6):779-81. doi: 10.1096/fj.02-0754fje. Epub 2003 Feb 5.
21.
Cyclooxygenase-2-Derived Prostaglandins Mediate Cerebral Microcirculation in a Juvenile Ischemic Rat Model.
Leger PL, etal., Stroke. 2016 Dec;47(12):3048-3052. doi: 10.1161/STROKEAHA.116.015095. Epub 2016 Nov 10.
22.
Variation in eicosanoid genes, non-fatal myocardial infarction and ischemic stroke.
Lemaitre RN, etal., Atherosclerosis. 2009 Jun;204(2):e58-63. Epub 2008 Nov 1.
23.
Cyclooxygenase-1 and bicistronic cyclooxygenase-1/prostacyclin synthase gene transfer protect against ischemic cerebral infarction.
Lin H, etal., Circulation. 2002 Apr 23;105(16):1962-9. doi: 10.1161/01.cir.0000015365.49180.05.
24.
Molecular mechanisms regulating the vascular prostacyclin pathways and their adaptation during pregnancy and in the newborn.
Majed BH and Khalil RA, Pharmacol Rev. 2012 Jul;64(3):540-82. doi: 10.1124/pr.111.004770. Epub 2012 Jun 7.
25.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
26.
Estrogen increases male rat aortic endothelial cell (RAEC) PGI2 release.
Myers SI, etal., Prostaglandins Leukot Essent Fatty Acids. 1996 Jun;54(6):403-9. doi: 10.1016/s0952-3278(96)90023-x.
27.
Gene transfer of human prostacyclin synthase ameliorates monocrotaline-induced pulmonary hypertension in rats.
Nagaya N, etal., Circulation. 2000 Oct 17;102(16):2005-10. doi: 10.1161/01.cir.102.16.2005.
28.
Association of a novel single nucleotide polymorphism of the prostacyclin synthase gene with myocardial infarction.
Nakayama T, etal., Am Heart J. 2002 May;143(5):797-801. doi: 10.1067/mhj.2002.122171.
29.
Association of 5' upstream promoter region of prostacyclin synthase gene variant with cerebral infarction.
Nakayama T, etal., Am J Hypertens. 2000 Dec;13(12):1263-7. doi: 10.1016/s0895-7061(00)01216-4.
30.
Splicing mutation of the prostacyclin synthase gene in a family associated with hypertension.
Nakayama T, etal., Biochem Biophys Res Commun 2002 Oct 11;297(5):1135-9.
31.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
32.
Prostacyclin synthase gene transfer accelerates reendothelialization and inhibits neointimal formation in rat carotid arteries after balloon injury.
Numaguchi Y, etal., Arterioscler Thromb Vasc Biol. 1999 Mar;19(3):727-33. doi: 10.1161/01.atv.19.3.727.
33.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
34.
17beta-estradiol increases rat cerebrovascular prostacyclin synthesis by elevating cyclooxygenase-1 and prostacyclin synthase.
Ospina JA, etal., Stroke. 2002 Feb;33(2):600-5. doi: 10.1161/hs0202.102732.
35.
Downregulation of PGI2 pathway in Pulmonary Hypertension Group-III patients.
Ozen G, etal., Prostaglandins Leukot Essent Fatty Acids. 2020 Sep;160:102158. doi: 10.1016/j.plefa.2020.102158. Epub 2020 Jul 5.
36.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
37.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
38.
Prostacyclin synthase and arachidonate 5-lipoxygenase polymorphisms and risk of colorectal polyps.
Poole EM, etal., Cancer Epidemiol Biomarkers Prev. 2006 Mar;15(3):502-8. doi: 10.1158/1055-9965.EPI-05-0804.
39.
GOA pipeline
RGD automated data pipeline
40.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
41.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
42.
Differential Expression of Prostaglandin I2 Synthase Associated with Arachidonic Acid Pathway in the Oral Squamous Cell Carcinoma.
Russo A, etal., J Oncol. 2018 Nov 8;2018:6301980. doi: 10.1155/2018/6301980. eCollection 2018.
43.
Reduced expression of prostacyclin synthase and nitric oxide synthase in subcutaneous arteries of type 2 diabetic patients.
Safiah Mokhtar S, etal., Tohoku J Exp Med. 2013 Nov;231(3):217-22. doi: 10.1620/tjem.231.217.
44.
Genetic-deletion of Cyclooxygenase-2 Downstream Prostacyclin Synthase Suppresses Inflammatory Reactions but Facilitates Carcinogenesis, unlike Deletion of Microsomal Prostaglandin E Synthase-1.
Sasaki Y, etal., Sci Rep. 2015 Nov 27;5:17376. doi: 10.1038/srep17376.
45.
Effects of selective and unselective endothelin-receptor antagonists on prostacyclin synthase gene expression in experimental pulmonary hypertension.
Schroll S, etal., Scand J Clin Lab Invest. 2008;68(4):270-6. doi: 10.1080/00365510701673375.
46.
PGI2 production by rat blood vessels: diminished prostacyclin formation in veins compared to arteries.
Skidgel RA and Printz MP, Prostaglandins 1978 Jul;16(1):1-16.
47.
Beneficial vasoactive endothelial effects of fluvastatin: focus on prostacyclin and nitric oxide.
Skogastierna C, etal., Heart Vessels. 2011 Nov;26(6):628-36. doi: 10.1007/s00380-010-0097-x. Epub 2011 Jan 7.
48.
Effect of an imidazolineoxyl nitric oxide on prostaglandin synthesis in experimental shock: possible role of nitrogen dioxide in prostacyclin synthase inactivation.
Soler M, etal., J Infect Dis. 2001 Jan 1;183(1):105-12. doi: 10.1086/317639. Epub 2000 Nov 10.
49.
Imidazolineoxyl N-oxide prevents the impairment of vascular contraction caused by interleukin-1beta through several mechanisms.
Soler M, etal., J Infect Dis. 2003 Sep 15;188(6):927-37. doi: 10.1086/377586. Epub 2003 Sep 4.
50.
Functional prostacyclin synthase promoter polymorphisms. Impact in pulmonary arterial hypertension.
Stearman RS, etal., Am J Respir Crit Care Med. 2014 May 1;189(9):1110-20. doi: 10.1164/rccm.201309-1697OC.
51.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
52.
Gene transfer of human prostacyclin synthase into the liver is effective for the treatment of pulmonary hypertension in rats.
Suhara H, etal., J Thorac Cardiovasc Surg. 2002 May;123(5):855-61. doi: 10.1067/mtc.2002.118687.
53.
Repeated gene transfer of naked prostacyclin synthase plasmid into skeletal muscles attenuates monocrotaline-induced pulmonary hypertension and prolongs survival in rats.
Tahara N, etal., Hum Gene Ther. 2004 Dec;15(12):1270-8.
54.
Gene expression changes of prostanoid synthases in endothelial cells and prostanoid receptors in vascular smooth muscle cells caused by aging and hypertension.
Tang EH and Vanhoutte PM, Physiol Genomics. 2008 Feb 19;32(3):409-18. doi: 10.1152/physiolgenomics.00136.2007. Epub 2007 Dec 4.
55.
Gene transfer of human prostacyclin synthase prevents neointimal formation after carotid balloon injury in rats.
Todaka T, etal., Stroke. 1999 Feb;30(2):419-26. doi: 10.1161/01.str.30.2.419.
56.
Enhanced prostacyclin synthesis by adenoviral gene transfer reduced glial activation and ameliorated dopaminergic dysfunction in hemiparkinsonian rats.
Tsai MJ, etal., Oxid Med Cell Longev. 2013;2013:649809. doi: 10.1155/2013/649809. Epub 2013 Apr 3.
57.
Association of Rare PTGIS Variants With Susceptibility and Pulmonary Vascular Response in Patients With Idiopathic Pulmonary Arterial Hypertension.
Wang XJ, etal., JAMA Cardiol. 2020 Jun 1;5(6):677-684. doi: 10.1001/jamacardio.2020.0479.
58.
Association of polymorphisms of PTGS2 and CYP8A1 with myocardial infarction.
Xie X, etal., Clin Chem Lab Med. 2009;47(3):347-52. doi: 10.1515/CCLM.2009.078.
59.
[Study on the association of cyclooxygenase-2 -765g>C and prostacyclin synthase C1117A polymorphisms and the risk of myocardial infarction in Uigur population of Xinjiang, China].
Xie X, etal., Zhonghua Liu Xing Bing Xue Za Zhi. 2008 Jun;29(6):598-603.
60.
Assessment of the genetic component of hypertension.
Yamada Y, etal., Am J Hypertens. 2006 Nov;19(11):1158-65. doi: 10.1016/j.amjhyper.2006.04.010.
61.
Interactions among Variants in Eicosanoid Genes Increase Risk of Atherothrombotic Stroke in Chinese Populations.
Yi X, etal., J Stroke Cerebrovasc Dis. 2017 Aug;26(8):1773-1780. doi: 10.1016/j.jstrokecerebrovasdis.2017.04.005. Epub 2017 May 3.
62.
Variants in COX-2, PTGIS, and TBXAS1 Are Associated with Carotid Artery or Intracranial Arterial Stenosis and Neurologic Deterioration in Ischemic Stroke Patients.
Yi X, etal., J Stroke Cerebrovasc Dis. 2017 May;26(5):1128-1135. doi: 10.1016/j.jstrokecerebrovasdis.2016.12.032. Epub 2017 Jan 17.
63.
Genetic variants of PTGS2, TXA2R and TXAS1 are associated with carotid plaque vulnerability, platelet activation and TXA2 levels in ischemic stroke patients.
Yi X, etal., PLoS One. 2017 Jul 12;12(7):e0180704. doi: 10.1371/journal.pone.0180704. eCollection 2017.
64.
Endothelial-like progenitor cells engineered to produce prostacyclin rescue monocrotaline-induced pulmonary arterial hypertension and provide right ventricle benefits.
Zhou L, etal., Circulation. 2013 Aug 27;128(9):982-94. doi: 10.1161/CIRCULATIONAHA.113.003139. Epub 2013 Jul 10.
65.
Oxymatrine attenuated isoproterenol-induced heart failure in rats via regulation of COX-2/PGI2 pathway.
Zhou R, etal., Biomed Pharmacother. 2016 Dec;84:1359-1366. doi: 10.1016/j.biopha.2016.10.070. Epub 2016 Oct 29.
66.
High glucose via peroxynitrite causes tyrosine nitration and inactivation of prostacyclin synthase that is associated with thromboxane/prostaglandin H(2) receptor-mediated apoptosis and adhesion molecule expression in cultured human aortic endothelial cells.
Zou MH, etal., Diabetes. 2002 Jan;51(1):198-203. doi: 10.2337/diabetes.51.1.198.
Ptgis Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 176,347,589 - 176,383,251 (-) NCBI GRCr8 mRatBN7.2 3 155,928,564 - 155,964,228 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 155,916,412 - 155,965,451 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 159,730,001 - 159,765,702 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 168,228,974 - 168,264,675 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 165,970,684 - 166,006,385 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 163,950,746 - 163,986,129 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 3 170,109,317 - 170,143,882 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 158,356,878 - 158,387,984 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 158,262,914 - 158,294,020 (-) NCBI Celera 3 154,508,773 - 154,544,997 (-) NCBI Celera Cytogenetic Map 3 q42 NCBI
PTGIS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 49,503,874 - 49,568,137 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 49,503,874 - 49,568,137 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 48,120,411 - 48,184,674 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 47,553,818 - 47,618,114 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 47,553,820 - 47,618,114 NCBI Celera 20 44,825,044 - 44,889,311 (-) NCBI Celera Cytogenetic Map 20 q13.13 NCBI HuRef 20 44,868,991 - 44,933,099 (-) NCBI HuRef CHM1_1 20 48,024,824 - 48,089,470 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 51,273,490 - 51,337,709 (-) NCBI T2T-CHM13v2.0
Ptgis Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 167,045,114 - 167,095,069 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 167,033,725 - 167,082,524 (-) Ensembl GRCm39 Ensembl GRCm38 2 167,203,194 - 167,252,150 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 167,191,805 - 167,240,604 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 167,028,696 - 167,066,037 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 166,894,401 - 166,931,742 (-) NCBI MGSCv36 mm8 Celera 2 173,143,332 - 173,180,671 (-) NCBI Celera Cytogenetic Map 2 H3 NCBI cM Map 2 87.22 NCBI
Ptgis Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955445 8,623,430 - 8,677,658 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955445 8,624,228 - 8,663,385 (+) NCBI ChiLan1.0 ChiLan1.0
PTGIS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 55,244,765 - 55,309,216 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 55,237,848 - 55,302,529 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 45,841,238 - 45,905,641 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 46,909,010 - 46,952,850 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 46,905,665 - 46,971,612 (-) Ensembl panpan1.1 panPan2
PTGIS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 36,129,091 - 36,162,525 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 36,132,173 - 36,162,509 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 35,371,271 - 35,411,412 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 36,836,800 - 36,873,631 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 36,821,516 - 36,873,620 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 36,074,715 - 36,114,829 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 36,208,769 - 36,248,925 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 36,750,911 - 36,791,264 (-) NCBI UU_Cfam_GSD_1.0
Ptgis Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 189,336,652 - 189,360,405 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 4,791,031 - 4,812,027 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 4,775,884 - 4,814,574 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PTGIS Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 51,153,154 - 51,200,300 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 51,153,151 - 51,200,515 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 57,474,357 - 57,521,683 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PTGIS Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 14,420,318 - 14,484,667 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 14,441,983 - 14,488,264 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 62,907,161 - 62,972,792 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ptgis
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 41 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000010891 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
12879876 Bw182 Body weight QTL 182 0.003 body mass (VT:0001259) body weight (CMO:0000012) 3 145925360 166177555 Rat 2301411 Bp320 Blood pressure QTL 320 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145925360 166177555 Rat 2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 1300113 Bp176 Blood pressure QTL 176 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 145956084 157309487 Rat 12879872 Cm97 Cardiac mass QTL 97 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 145925360 166177555 Rat 1598877 Bp285 Blood pressure QTL 285 1.5 0.03 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 120538241 165538241 Rat 1578653 Vnigr3 Vascular neointimal growth QTL 3 3.1 artery morphology trait (VT:0002191) artery neointimal hyperplastic lesion area (CMO:0001414) 3 130656562 169034231 Rat 12879873 Cm96 Cardiac mass QTL 96 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 145925360 166177555 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 12879874 Cm98 Cardiac mass QTL 98 0.005 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 145925360 166177555 Rat 1298068 Bp167 Blood pressure QTL 167 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 141074471 169034231 Rat 12879875 Kidm64 Kidney mass QTL 64 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 145925360 166177555 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2298477 Eau4 Experimental allergic uveoretinitis QTL 4 0.0011 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 3 137398739 169034231 Rat 8552791 Vie2 Viral induced encephalitis QTL 2 4.1 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 3 145956084 169034231 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 2317883 Alcrsp26 Alcohol response QTL 26 1.8 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 3 145526770 169034231 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1331726 Bp208 Blood pressure QTL 208 3.129 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 141339013 162184794 Rat 1598854 Memor10 Memory QTL 10 2 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 3 145956084 161299569 Rat 9589106 Insul23 Insulin level QTL 23 13.86 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 3 131635904 169034231 Rat 10755461 Coatc16 Coat color QTL 16 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 3 122438700 167438700 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2303620 Vencon4 Ventilatory control QTL 4 3.9 respiration trait (VT:0001943) tidal volume (CMO:0000222) 3 127162703 168026850 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1576306 Schws3 Schwannoma susceptibility QTL 3 0.001 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 3 118839124 163839124 Rat 1300159 Kidm4 Kidney mass QTL 4 3.83 kidney mass (VT:0002707) right kidney wet weight to body weight ratio (CMO:0001953) 3 121056165 157309487 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 631673 Iddm13 Insulin dependent diabetes mellitus QTL 13 1.3 0.663 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 3 130193298 161695983 Rat 1578666 Vnigr1 Vascular neointimal growth QTL 1 4.6 artery morphology trait (VT:0002191) artery lumen area (CMO:0001409) 3 149040888 168026850 Rat 1578656 Vnigr2 Vascular neointimal growth QTL 2 4.2 artery morphology trait (VT:0002191) lesioned artery residual lumen area (CMO:0001417) 3 130656562 169034231 Rat 8552952 Pigfal13 Plasma insulin-like growth factor 1 level QTL 13 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 138799500 169034231 Rat 12879871 Am7 Aortic mass QTL 7 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 145925360 166177555 Rat 631541 Bp81 Blood pressure QTL 81 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 124122556 169034231 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat
D3Got155
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,951,423 - 155,951,573 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,973,327 - 163,973,476 NCBI Rnor6.0 Rnor_5.0 3 170,131,080 - 170,131,229 UniSTS Rnor5.0 Celera 3 154,532,212 - 154,532,361 UniSTS RH 3.4 Map 3 1441.6 RGD RH 3.4 Map 3 1441.6 UniSTS Cytogenetic Map 3 q42 UniSTS
AW529446
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,943,587 - 155,943,756 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,965,193 - 163,965,361 NCBI Rnor6.0 Rnor_5.0 3 170,124,593 - 170,124,761 UniSTS Rnor5.0 Celera 3 154,524,558 - 154,524,726 UniSTS RH 3.4 Map 3 1442.4 UniSTS Cytogenetic Map 3 q42 UniSTS
RH130734
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,928,598 - 155,928,784 (-) MAPPER mRatBN7.2 mRatBN7.2 3 155,928,598 - 155,928,784 (+) MAPPER mRatBN7.2 mRatBN7.2 11 52,245,400 - 52,245,586 (-) MAPPER mRatBN7.2 mRatBN7.2 11 52,245,400 - 52,245,586 (+) MAPPER mRatBN7.2 Rnor_6.0 11 54,830,061 - 54,830,246 NCBI Rnor6.0 Rnor_6.0 3 163,950,781 - 163,950,966 NCBI Rnor6.0 Rnor_5.0 3 170,109,352 - 170,109,537 UniSTS Rnor5.0 Rnor_5.0 11 57,988,636 - 57,988,821 UniSTS Rnor5.0 RGSC_v3.4 3 158,356,913 - 158,357,098 UniSTS RGSC3.4 RGSC_v3.4 11 53,492,284 - 53,492,469 UniSTS RGSC3.4 Celera 11 51,841,764 - 51,841,949 UniSTS Celera 3 154,508,808 - 154,508,993 UniSTS RH 3.4 Map 2 755.19 UniSTS Cytogenetic Map 11 q21 UniSTS Cytogenetic Map 3 q42 UniSTS
BI275702
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 155,931,041 - 155,931,252 (+) MAPPER mRatBN7.2 Rnor_6.0 3 163,953,224 - 163,953,434 NCBI Rnor6.0 Rnor_5.0 3 170,111,795 - 170,112,005 UniSTS Rnor5.0 Celera 3 154,511,251 - 154,511,461 UniSTS RH 3.4 Map 3 1441.5 UniSTS Cytogenetic Map 3 q42 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000010891 ⟹ ENSRNOP00000010891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,928,564 - 155,951,645 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082474 ⟹ ENSRNOP00000074093
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,928,564 - 155,953,292 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103286 ⟹ ENSRNOP00000088713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,916,412 - 155,965,451 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105814 ⟹ ENSRNOP00000077774
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,925,619 - 155,964,267 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115486 ⟹ ENSRNOP00000087709
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 155,928,570 - 155,965,451 (-) Ensembl
RefSeq Acc Id:
NM_031557 ⟹ NP_113745
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 176,347,589 - 176,383,251 (-) NCBI mRatBN7.2 3 155,928,564 - 155,964,228 (-) NCBI Rnor_6.0 3 163,950,746 - 163,986,129 (-) NCBI Rnor_5.0 3 170,109,317 - 170,143,882 (-) NCBI RGSC_v3.4 3 158,356,878 - 158,387,984 (-) RGD Celera 3 154,508,773 - 154,544,997 (-) RGD
Sequence:
CTGAGCTGAGGATCCTGCGGTTCGGTGTTGGTGGCGGTGACCTGTTGCCACCCGGCAGCCGCACACCCTCGAGCCATGTCCTGGGCCGCTCTGCTCGGCCTTCTGGCCGTGTTATTACTGTTGCTGCT
hide sequence
RefSeq Acc Id:
XM_039104378 ⟹ XP_038960306
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 176,347,589 - 176,371,870 (-) NCBI mRatBN7.2 3 155,928,564 - 155,952,790 (-) NCBI
RefSeq Acc Id:
NP_113745 ⟸ NM_031557
- UniProtKB:
Q62969 (UniProtKB/Swiss-Prot), A6JXJ3 (UniProtKB/TrEMBL)
- Sequence:
MSWAALLGLLAVLLLLLLLLSRRRARRPGEPPLDLGSIPWLGHALEFGKDAASFLTRMKEKHGDIFTVLVGGRYVTVLLDPHSYDTVVWDLRTRLDFHPYAIFLMERIFDLQLPNFNPSEEKARMKPT
hide sequence
RefSeq Acc Id:
XP_038960306 ⟸ XM_039104378
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K776 (UniProtKB/TrEMBL), F1LP67 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000087709 ⟸ ENSRNOT00000115486
Ensembl Acc Id:
ENSRNOP00000074093 ⟸ ENSRNOT00000082474
Ensembl Acc Id:
ENSRNOP00000010891 ⟸ ENSRNOT00000010891
Ensembl Acc Id:
ENSRNOP00000077774 ⟸ ENSRNOT00000105814
Ensembl Acc Id:
ENSRNOP00000088713 ⟸ ENSRNOT00000103286
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-09-21
Ptgis
prostaglandin I2 synthase
Ptgis
prostaglandin I2 (prostacyclin) synthase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Ptgis
prostaglandin I2 (prostacyclin) synthase
prostaglandin I2 synthase
Name updated
1299863 APPROVED
2003-04-09
Ptgis
prostaglandin I2 synthase
Prostaglandin I2 (prostacyclin) synthase
Name updated
629478 APPROVED
2002-06-10
Ptgis
Prostaglandin I2 (prostacyclin) synthase
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_mutations_overexpression
overexpression in transgenic mice provides protection against severe pulmonary hypertension
727270
