Symbol:
Prph
Name:
peripherin
RGD ID:
3414
Description:
Predicted to be a structural constituent of cytoskeleton. Involved in intermediate filament cytoskeleton organization. Located in neuronal cell body; terminal bouton; and type III intermediate filament. Human ortholog(s) of this gene implicated in amyotrophic lateral sclerosis type 1. Orthologous to human PRPH (peripherin); PARTICIPATES IN amyotrophic lateral sclerosis pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Perf; peripherin 1; Prph1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRPH (peripherin) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Prph (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prph (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRPH (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRPH (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prph (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRPH (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRPH (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prph (peripherin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
WDR62 (WD repeat domain 62) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Prph (peripherin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PRPH (peripherin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prph (peripherin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ifd-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA)
Xenopus tropicalis (tropical clawed frog):
prph
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,096,888 - 132,101,070 (+) NCBI GRCr8 mRatBN7.2 7 130,218,149 - 130,222,136 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,218,357 - 130,222,136 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,028,577 - 132,032,350 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,254,151 - 134,257,924 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,166,656 - 134,170,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 140,742,406 - 140,746,197 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 140,742,418 - 140,746,197 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,247,151 - 115,251,138 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 137,836,152 - 137,839,931 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 137,912,601 - 137,916,363 (+) NCBI Celera 7 126,703,099 - 126,706,878 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prph Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PRPH mRNA CTD PMID:32145629 Prph Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRPH mRNA CTD PMID:32109520 Prph Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRPH mRNA CTD PMID:34747641 Prph Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Prph (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Prph Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Prph Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Prph Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Prph (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PRPH mRNA CTD PMID:20188158 Prph Rat 4,4'-sulfonyldiphenol increases expression ISO Prph (Mus musculus) 6480464 bisphenol S results in increased expression of PRPH mRNA CTD PMID:30951980 Prph Rat 4,4'-sulfonyldiphenol increases methylation ISO Prph (Mus musculus) 6480464 bisphenol S results in increased methylation of PRPH promoter CTD PMID:33297965 Prph Rat 4,4'-sulfonyldiphenol multiple interactions ISO Prph (Mus musculus) 6480464 [bisphenol S co-treated with LIF protein] results in decreased expression of PRPH mRNA CTD PMID:30951980 Prph Rat 5-aza-2'-deoxycytidine affects expression ISO PRPH (Homo sapiens) 6480464 Decitabine affects the expression of PRPH mRNA CTD PMID:23300844 Prph Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PRPH mRNA CTD PMID:24780913 Prph Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PRPH mRNA CTD PMID:31881176 Prph Rat alachlor increases expression EXP 6480464 alachlor results in increased expression of PRPH mRNA CTD PMID:12419858 Prph Rat all-trans-retinoic acid increases expression ISO Prph (Mus musculus) 6480464 Tretinoin results in increased expression of PRPH mRNA CTD PMID:16604517 Prph Rat all-trans-retinoic acid multiple interactions ISO Prph (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PRPH mRNA CTD PMID:36189433 Prph Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PRPH mRNA CTD PMID:30779732 Prph Rat aristolochic acid A increases expression ISO PRPH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PRPH mRNA CTD PMID:33212167 Prph Rat arsane multiple interactions ISO PRPH (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PRPH mRNA CTD PMID:32525701 Prph Rat arsenic atom multiple interactions ISO PRPH (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PRPH mRNA CTD PMID:32525701 Prph Rat arsenite(3-) increases methylation ISO PRPH (Homo sapiens) 6480464 arsenite results in increased methylation of PRPH promoter CTD PMID:23974009 Prph Rat atrazine increases expression ISO PRPH (Homo sapiens) 6480464 Atrazine results in increased expression of PRPH mRNA CTD PMID:22378314 Prph Rat benzo[a]pyrene multiple interactions ISO Prph (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to PRPH promoter] CTD PMID:19654925 Prph Rat benzo[a]pyrene multiple interactions EXP 6480464 sodium arsenate promotes the reaction [Benzo(a)pyrene results in decreased expression of PRPH mRNA] and sodium arsenate promotes the reaction [Benzo(a)pyrene results in decreased expression of PRPH protein] CTD PMID:16456883 Prph Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PRPH mRNA and Benzo(a)pyrene results in decreased expression of PRPH protein CTD PMID:16456883 Prph Rat bis(2-ethylhexyl) phthalate decreases expression ISO PRPH (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PRPH mRNA CTD PMID:31163220 Prph Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PRPH mRNA CTD PMID:25181051 Prph Rat bisphenol A decreases expression ISO PRPH (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRPH protein CTD PMID:34186270 Prph Rat bisphenol A increases expression ISO Prph (Mus musculus) 6480464 bisphenol A results in increased expression of PRPH mRNA CTD PMID:32156529 Prph Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRPH mRNA CTD PMID:32145629 Prph Rat bisphenol A affects expression ISO Prph (Mus musculus) 6480464 bisphenol A affects the expression of PRPH mRNA CTD PMID:30951980 Prph Rat butanal increases expression ISO PRPH (Homo sapiens) 6480464 butyraldehyde results in increased expression of PRPH mRNA CTD PMID:26079696 Prph Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat cadmium dichloride decreases expression ISO PRPH (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PRPH mRNA CTD PMID:38382870 Prph Rat caffeine decreases expression ISO PRPH (Homo sapiens) 6480464 Caffeine results in decreased expression of PRPH protein CTD PMID:31195006 Prph Rat cannabidiol increases expression ISO PRPH (Homo sapiens) 6480464 Cannabidiol results in increased expression of PRPH mRNA CTD PMID:33244087 Prph Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of PRPH mRNA CTD PMID:19395590 Prph Rat carmustine decreases expression EXP 6480464 Carmustine results in decreased expression of PRPH mRNA CTD PMID:16005536 Prph Rat chlordecone decreases expression ISO Prph (Mus musculus) 6480464 Chlordecone results in decreased expression of PRPH mRNA CTD PMID:33711761 Prph Rat cisplatin affects expression ISO PRPH (Homo sapiens) 6480464 Cisplatin affects the expression of PRPH mRNA CTD PMID:23300844 Prph Rat copper atom multiple interactions ISO PRPH (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PRPH mRNA CTD PMID:20971185 Prph Rat copper(0) multiple interactions ISO PRPH (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PRPH mRNA CTD PMID:20971185 Prph Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PRPH mRNA CTD PMID:26577399 Prph Rat cyclosporin A increases expression ISO PRPH (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRPH mRNA CTD PMID:25562108 Prph Rat cytarabine decreases expression ISO PRPH (Homo sapiens) 6480464 Cytarabine results in decreased expression of PRPH mRNA CTD PMID:21198554 Prph Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRPH mRNA CTD PMID:24893172 Prph Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of PRPH mRNA CTD PMID:31199487 Prph Rat dimethyl sulfoxide affects expression ISO PRPH (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of PRPH mRNA CTD PMID:24834073 Prph Rat doxorubicin increases oxidation EXP 6480464 Doxorubicin results in increased oxidation of PRPH protein CTD PMID:28818578 Prph Rat epoxiconazole increases expression ISO Prph (Mus musculus) 6480464 epoxiconazole results in increased expression of PRPH mRNA CTD PMID:35436446 Prph Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PRPH mRNA CTD PMID:18035473 Prph Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of PRPH mRNA CTD PMID:38314887 Prph Rat hyaluronic acid decreases expression EXP 6480464 Hyaluronic Acid analog results in decreased expression of PRPH protein CTD PMID:23178681 Prph Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PRPH protein CTD PMID:23178681 Prph Rat iron dichloride decreases expression ISO PRPH (Homo sapiens) 6480464 ferrous chloride results in decreased expression of PRPH mRNA CTD PMID:35984750 Prph Rat ivermectin decreases expression ISO PRPH (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRPH protein CTD PMID:32959892 Prph Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of PRPH mRNA CTD PMID:16507785 Prph Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of PRPH mRNA CTD PMID:16005536 Prph Rat mono(2-ethylhexyl) phthalate decreases expression ISO Prph (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PRPH mRNA CTD PMID:22401849 Prph Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Prph (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of PRPH mRNA CTD PMID:36189433 Prph Rat pentanal increases expression ISO PRPH (Homo sapiens) 6480464 pentanal results in increased expression of PRPH mRNA CTD PMID:26079696 Prph Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PRPH mRNA CTD PMID:16221955 Prph Rat propanal increases expression ISO PRPH (Homo sapiens) 6480464 propionaldehyde results in increased expression of PRPH mRNA CTD PMID:26079696 Prph Rat silicon dioxide increases expression ISO PRPH (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PRPH mRNA CTD PMID:25895662 Prph Rat sodium arsenate multiple interactions EXP 6480464 sodium arsenate promotes the reaction [Benzo(a)pyrene results in decreased expression of PRPH mRNA] and sodium arsenate promotes the reaction [Benzo(a)pyrene results in decreased expression of PRPH protein] CTD PMID:16456883 Prph Rat sodium arsenate multiple interactions ISO PRPH (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of PRPH mRNA CTD PMID:32525701 Prph Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PRPH protein CTD PMID:29459688 Prph Rat sodium arsenite decreases expression ISO Prph (Mus musculus) 6480464 sodium arsenite results in decreased expression of PRPH mRNA CTD PMID:37682722 Prph Rat sodium arsenite decreases expression ISO PRPH (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRPH mRNA CTD PMID:34032870 Prph Rat sodium arsenite increases expression ISO PRPH (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRPH mRNA CTD PMID:38568856 Prph Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PRPH mRNA CTD PMID:22561333 Prph Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of PRPH protein CTD PMID:30583000 Prph Rat sulforaphane affects binding ISO PRPH (Homo sapiens) 6480464 PRPH protein binds to sulforaphane CTD PMID:21838287 Prph Rat sunitinib increases expression ISO PRPH (Homo sapiens) 6480464 Sunitinib results in increased expression of PRPH mRNA CTD PMID:31533062 Prph Rat temozolomide increases expression ISO PRPH (Homo sapiens) 6480464 Temozolomide results in increased expression of PRPH mRNA CTD PMID:31758290 Prph Rat thapsigargin increases expression ISO PRPH (Homo sapiens) 6480464 Thapsigargin results in increased expression of PRPH mRNA CTD PMID:22378314 Prph Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PRPH protein CTD PMID:35544339 Prph Rat tioguanine decreases expression EXP 6480464 Thioguanine results in decreased expression of PRPH mRNA CTD PMID:16005536 Prph Rat titanium dioxide decreases methylation ISO Prph (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRPH gene CTD PMID:35295148 Prph Rat triclosan increases expression ISO PRPH (Homo sapiens) 6480464 Triclosan results in increased expression of PRPH mRNA CTD PMID:30510588 Prph Rat triptonide increases expression ISO Prph (Mus musculus) 6480464 triptonide results in increased expression of PRPH mRNA CTD PMID:33045310 Prph Rat troglitazone increases expression ISO Prph (Mus musculus) 6480464 troglitazone results in increased expression of PRPH mRNA CTD PMID:28973697 Prph Rat tunicamycin increases expression ISO PRPH (Homo sapiens) 6480464 Tunicamycin results in increased expression of PRPH mRNA CTD PMID:29453283 Prph Rat valproic acid increases expression ISO Prph (Mus musculus) 6480464 Valproic Acid results in increased expression of PRPH mRNA CTD PMID:21427059 Prph Rat valproic acid affects expression ISO PRPH (Homo sapiens) 6480464 Valproic Acid affects the expression of PRPH mRNA CTD PMID:25979313 Prph Rat valproic acid decreases expression ISO PRPH (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PRPH mRNA CTD PMID:23179753 and PMID:27188386 Prph Rat valproic acid increases expression ISO PRPH (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRPH mRNA CTD PMID:28001369
Imported Annotations - KEGG (archival)
17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) alachlor (EXP) all-trans-retinoic acid (ISO) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) butanal (ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (ISO) caffeine (ISO) cannabidiol (ISO) carbonyl sulfide (EXP) carmustine (EXP) chlordecone (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclosporin A (ISO) cytarabine (ISO) dibutyl phthalate (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dimethyl sulfoxide (ISO) doxorubicin (EXP) epoxiconazole (ISO) flavonoids (EXP) glyphosate (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) iron dichloride (ISO) ivermectin (ISO) mercury dichloride (EXP) methotrexate (EXP) mono(2-ethylhexyl) phthalate (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (EXP) propanal (ISO) silicon dioxide (ISO) sodium arsenate (EXP,ISO) sodium arsenite (EXP,ISO) sodium dichromate (EXP) streptozocin (EXP) sulforaphane (ISO) sunitinib (ISO) temozolomide (ISO) thapsigargin (EXP,ISO) tioguanine (EXP) titanium dioxide (ISO) triclosan (ISO) triptonide (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
Correlation between genetic and cytogenetic maps of the rat.
Andoh Y, etal., Mamm Genome 1998 Apr;9(4):287-93.
2.
Heterodimeric associations between neuronal intermediate filament proteins.
Athlan ES and Mushynski WE, J Biol Chem. 1997 Dec 5;272(49):31073-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Translation initiation and assembly of peripherin in cultured cells.
Ho CL, etal., Eur J Cell Biol 1995 Oct;68(2):103-12.
6.
The intermediate filament protein peripherin is the specific interaction partner of mouse BPAG1-n (dystonin) in neurons.
Leung CL, etal., J Cell Biol. 1999 Feb 8;144(3):435-46.
7.
Peripherin immunoreactivity labels small diameter vestibular 'bouton' afferents in rodents.
Lysakowski A, etal., Hear Res. 1999 Jul;133(1-2):149-54.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Alternative neural crest cell fates are instructively promoted by TGFbeta superfamily members.
Shah NM, etal., Cell. 1996 May 3;85(3):331-43.
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
Structure of the gene encoding peripherin, an NGF-regulated neuronal-specific type III intermediate filament protein.
Thompson MA and Ziff EB, Neuron 1989 Jan;2(1):1043-53.
Prph Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 132,096,888 - 132,101,070 (+) NCBI GRCr8 mRatBN7.2 7 130,218,149 - 130,222,136 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 130,218,357 - 130,222,136 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 132,028,577 - 132,032,350 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 134,254,151 - 134,257,924 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 134,166,656 - 134,170,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 140,742,406 - 140,746,197 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 140,742,418 - 140,746,197 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 115,247,151 - 115,251,138 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 137,836,152 - 137,839,931 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 137,912,601 - 137,916,363 (+) NCBI Celera 7 126,703,099 - 126,706,878 (+) NCBI Celera Cytogenetic Map 7 q36 NCBI
PRPH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 49,295,147 - 49,298,686 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 49,295,147 - 49,298,686 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 49,688,930 - 49,692,469 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 47,975,176 - 47,978,748 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 47,975,250 - 47,978,732 NCBI Celera 12 48,481,731 - 48,485,303 (+) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 46,719,777 - 46,723,549 (+) NCBI HuRef CHM1_1 12 49,654,607 - 49,658,179 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 49,257,338 - 49,260,877 (+) NCBI T2T-CHM13v2.0
Prph Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 98,951,452 - 98,956,858 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 98,953,055 - 98,956,859 (+) Ensembl GRCm39 Ensembl GRCm38 15 99,053,579 - 99,058,978 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 99,055,174 - 99,058,978 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 98,885,605 - 98,889,409 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 98,883,241 - 98,886,704 (+) NCBI MGSCv36 mm8 Celera 15 101,208,902 - 101,212,694 (+) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 55.72 NCBI
Prph Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955500 8,107,847 - 8,117,290 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955500 8,106,371 - 8,117,221 (+) NCBI ChiLan1.0 ChiLan1.0
PRPH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 44,885,322 - 44,894,946 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 44,882,083 - 44,888,844 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 39,451,832 - 39,456,800 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 40,337,626 - 40,342,611 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 40,337,626 - 40,342,611 (-) Ensembl panpan1.1 panPan2
PRPH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 5,314,815 - 5,320,270 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 5,314,807 - 5,320,089 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 40,928,170 - 40,941,768 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 5,366,381 - 5,380,010 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 5,366,389 - 5,371,465 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 5,331,470 - 5,344,950 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 5,320,895 - 5,334,284 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 41,321,186 - 41,334,583 (+) NCBI UU_Cfam_GSD_1.0
Prph Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 66,113,872 - 66,118,583 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 7,047,253 - 7,051,007 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 7,046,275 - 7,050,958 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRPH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 15,285,294 - 15,288,798 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 15,283,399 - 15,288,800 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 16,146,476 - 16,176,379 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRPH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 45,520,506 - 45,525,548 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 45,522,059 - 45,525,212 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 200,604,408 - 200,624,925 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prph
.
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 49 Interacting mature miRNAs: 52 Transcripts: ENSRNOT00000021010 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Wox24
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 132,099,989 - 132,100,123 (+) Marker Load Pipeline Rnor_5.0 X 115,250,056 - 115,250,191 NCBI Rnor5.0 RGSC_v3.4 7 137,838,850 - 137,838,984 RGD RGSC3.4 RGSC_v3.1 7 137,915,287 - 137,915,421 RGD RH 3.4 Map 7 1132.72 UniSTS RH 3.4 Map 7 1132.72 RGD RH 2.0 Map 7 825.6 RGD Cytogenetic Map 7 q34 UniSTS
D7Mit9
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 132,099,939 - 132,100,215 (+) Marker Load Pipeline mRatBN7.2 7 130,221,005 - 130,221,281 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,745,067 - 140,745,342 NCBI Rnor6.0 Rnor_5.0 X 115,250,008 - 115,250,283 UniSTS Rnor5.0 RGSC_v3.4 7 137,838,800 - 137,839,076 RGD RGSC3.4 RGSC_v3.4 7 137,838,801 - 137,839,076 UniSTS RGSC3.4 RGSC_v3.1 7 137,915,237 - 137,915,513 RGD Celera 7 126,705,748 - 126,706,023 UniSTS RH 3.4 Map 7 1075.1 UniSTS RH 3.4 Map 7 1075.1 RGD RH 2.0 Map 7 786.2 RGD SHRSP x BN Map 7 86.2099 RGD Cytogenetic Map 7 q34 UniSTS
RH133745
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,221,976 - 130,222,134 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,746,038 - 140,746,195 NCBI Rnor6.0 Rnor_5.0 X 115,250,979 - 115,251,136 UniSTS Rnor5.0 RGSC_v3.4 7 137,839,772 - 137,839,929 UniSTS RGSC3.4 Celera 7 126,706,719 - 126,706,876 UniSTS RH 3.4 Map 7 1087.6 UniSTS Cytogenetic Map 7 q34 UniSTS
RH94483
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 132,100,980 - 132,101,156 (+) Marker Load Pipeline mRatBN7.2 7 130,222,046 - 130,222,222 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,746,108 - 140,746,283 NCBI Rnor6.0 Rnor_5.0 X 115,251,049 - 115,251,224 UniSTS Rnor5.0 RGSC_v3.4 7 137,839,842 - 137,840,017 UniSTS RGSC3.4 Celera 7 126,706,789 - 126,706,964 UniSTS Cytogenetic Map 7 q34 UniSTS
PMC104164P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 130,219,958 - 130,220,612 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,744,020 - 140,744,673 NCBI Rnor6.0 Rnor_5.0 X 115,248,961 - 115,249,614 UniSTS Rnor5.0 RGSC_v3.4 7 137,837,754 - 137,838,407 UniSTS RGSC3.4 Celera 7 126,704,701 - 126,705,354 UniSTS Cytogenetic Map 7 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000089211 ⟹ ENSRNOP00000072008
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 130,218,357 - 130,222,136 (+) Ensembl Rnor_6.0 Ensembl 7 140,742,418 - 140,746,197 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094354 ⟹ ENSRNOP00000097710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 130,218,357 - 130,222,136 (+) Ensembl
RefSeq Acc Id:
NM_012633 ⟹ NP_036765
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,097,289 - 132,101,066 (+) NCBI mRatBN7.2 7 130,218,355 - 130,222,132 (+) NCBI Rnor_6.0 7 140,742,418 - 140,746,197 (+) NCBI Rnor_5.0 X 115,247,151 - 115,251,138 (+) NCBI RGSC_v3.4 7 137,836,152 - 137,839,931 (+) RGD Celera 7 126,703,099 - 126,706,878 (+) RGD
Sequence:
GCCCGGCCTAGTTCTGCCAAGCGCTGAATGCCATCTTCCGCCAGCATGAGCCATCACTCGTCGGGCCTCCGGTCCAGCATCAGCTCCACCTCATACCGCCGGACCTTCGGGCCACCGCCCTCACTGTC
hide sequence
RefSeq Acc Id:
XM_006257321 ⟹ XP_006257383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,096,902 - 132,101,070 (+) NCBI mRatBN7.2 7 130,218,149 - 130,222,136 (+) NCBI Rnor_6.0 7 140,742,406 - 140,746,193 (+) NCBI Rnor_5.0 X 115,247,151 - 115,251,138 (+) NCBI
Sequence:
CAGCTCCTTCCCGCCCGGCCTAGTTCTGCCAAGCGCTGAATGCCATCTTCCGCCAGCATGAGCCATCACTCGTCGGGCCTCCGGTCCAGCATCAGCTCCACCTCATACCGCCGGACCTTCGGGCCACC
hide sequence
RefSeq Acc Id:
XM_008765669 ⟹ XP_008763891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,096,888 - 132,101,070 (+) NCBI mRatBN7.2 7 130,218,149 - 130,222,136 (+) NCBI Rnor_6.0 7 140,742,406 - 140,746,197 (+) NCBI
Sequence:
CAGCTCCTTCCCGCCCGGCCTAGTTCTGCCAAGCGCTGAATGCCATCTTCCGCCAGCATGAGCCATCACTCGTCGGGCCTCCGGTCCAGCATCAGCTCCACCTCATACCGCCGGACCTTCGGGCCACC
hide sequence
RefSeq Acc Id:
XM_063262998 ⟹ XP_063119068
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 132,096,916 - 132,101,070 (+) NCBI
RefSeq Acc Id:
NP_036765 ⟸ NM_012633
- UniProtKB:
P21807 (UniProtKB/Swiss-Prot), A6KCD5 (UniProtKB/TrEMBL)
- Sequence:
MPSSASMSHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAPRAGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAAL
hide sequence
RefSeq Acc Id:
XP_006257383 ⟸ XM_006257321
- Peptide Label:
isoform X1
- UniProtKB:
P21807 (UniProtKB/Swiss-Prot), A6KCD4 (UniProtKB/TrEMBL)
- Sequence:
MPSSASMSHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAPRAGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAAL
hide sequence
RefSeq Acc Id:
XP_008763891 ⟸ XM_008765669
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AT59 (UniProtKB/TrEMBL), Q496Z5 (UniProtKB/TrEMBL)
- Sequence:
MPSSASMSHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAPRAGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000072008 ⟸ ENSRNOT00000089211
Ensembl Acc Id:
ENSRNOP00000097710 ⟸ ENSRNOT00000094354
RefSeq Acc Id:
XP_063119068 ⟸ XM_063262998
- Peptide Label:
isoform X3
- UniProtKB:
F1M7P4 (UniProtKB/TrEMBL), Q496Z5 (UniProtKB/TrEMBL)
RGD ID: 13695638 Promoter ID: EPDNEW_R6163 Type: single initiation site Name: Prph_1 Description: peripherin SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 140,742,412 - 140,742,472 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-17
Prph
peripherin
Prph1
peripherin 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Prph1
peripherin 1
Prph
Peripherin
Symbol and Name updated
629477 APPROVED
2002-06-10
Prph
Peripherin
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in brain
633740
gene_regulation
expression is regulated by NGF
633741
