Symbol:
Plod2
Name:
procollagen lysine, 2-oxoglutarate 5-dioxygenase 2
RGD ID:
3353
Description:
Predicted to enable procollagen-lysine 5-dioxygenase activity. Involved in cellular response to hormone stimulus and response to hypoxia. Predicted to be located in rough endoplasmic reticulum membrane. Predicted to be active in several cellular components, including Golgi apparatus; endoplasmic reticulum; and extracellular space. Biomarker of hypothyroidism. Orthologous to human PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2); PARTICIPATES IN lysine degradation pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LH2; lysyl hydroxylase 2; Procollagen-lysine 2-oxoglutarate 5-dioxygenase (Lysine hydroxylase) 2; Procollagen-lysine, 2-oxoglutarate 5-dioxygenase (Lysine hydroxylase) 2; procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2; procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Plod2 (procollagen lysine, 2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plod2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plod2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plod2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Plod2 (procollagen lysine, 2-oxoglutarate 5-dioxygenase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLOD2 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 2)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
plod2 (procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-268
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Plod
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
plod2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 101,964,318 - 102,047,022 (+) NCBI GRCr8 mRatBN7.2 8 93,084,548 - 93,167,255 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 93,084,513 - 93,167,255 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 98,757,951 - 98,827,969 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 96,957,203 - 97,027,220 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 94,787,446 - 94,864,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 99,977,334 - 100,059,736 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 99,977,334 - 100,059,736 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 99,462,925 - 99,529,696 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 8 99,543,695 - 99,545,578 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 97,525,279 - 97,623,152 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 97,544,733 - 97,642,604 (+) NCBI Celera 8 92,602,361 - 92,678,608 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plod2 Rat 1,1-dichloroethene decreases expression ISO Plod2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PLOD2 mRNA CTD PMID:26682919 Plod2 Rat 1,2-dimethylhydrazine increases expression ISO Plod2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLOD2 mRNA CTD PMID:22206623 Plod2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PLOD2 mRNA CTD PMID:25380136 and PMID:30723492 Plod2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PLOD2 mRNA CTD PMID:12075121 Plod2 Rat 17beta-estradiol increases expression ISO PLOD2 (Homo sapiens) 6480464 Estradiol results in increased expression of PLOD2 mRNA CTD PMID:20106945 Plod2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLOD2 mRNA CTD PMID:32741896 Plod2 Rat 17beta-estradiol increases expression ISO Plod2 (Mus musculus) 6480464 Estradiol results in increased expression of PLOD2 mRNA CTD PMID:19484750 Plod2 Rat 17beta-estradiol multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of PLOD2 mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of PLOD2 mRNA CTD PMID:20404318 and PMID:30165855 Plod2 Rat 17beta-estradiol affects expression ISO PLOD2 (Homo sapiens) 6480464 Estradiol affects the expression of PLOD2 mRNA CTD PMID:14699072 Plod2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLOD2 mRNA CTD PMID:32741896 Plod2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PLOD2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PLOD2 mRNA CTD PMID:29581250 Plod2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Plod2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLOD2 mRNA CTD PMID:18691609 and PMID:19770486 Plod2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PLOD2 mRNA CTD PMID:34747641 Plod2 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Plod2 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of PLOD2 mRNA CTD PMID:18200517 Plod2 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Plod2 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of PLOD2 mRNA] CTD PMID:18200517 Plod2 Rat 2-bromohexadecanoic acid multiple interactions ISO PLOD2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PLOD2 protein] CTD PMID:38195004 Plod2 Rat 2-hydroxypropanoic acid decreases expression ISO PLOD2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PLOD2 mRNA CTD PMID:30851411 Plod2 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PLOD2 mRNA CTD PMID:25380136 Plod2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Plod2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PLOD2 mRNA CTD PMID:18648102 Plod2 Rat 4,4'-sulfonyldiphenol increases expression ISO Plod2 (Mus musculus) 6480464 bisphenol S results in increased expression of PLOD2 mRNA CTD PMID:30951980 Plod2 Rat 4-hydroxyphenyl retinamide increases expression ISO Plod2 (Mus musculus) 6480464 Fenretinide results in increased expression of PLOD2 mRNA CTD PMID:28973697 Plod2 Rat 5-fluorouracil increases expression ISO PLOD2 (Homo sapiens) 6480464 Fluorouracil results in increased expression of PLOD2 protein CTD PMID:15352031 Plod2 Rat 5-fluorouracil decreases expression ISO PLOD2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of PLOD2 mRNA CTD PMID:16557594 Plod2 Rat 5-fluorouracil affects response to substance ISO PLOD2 (Homo sapiens) 6480464 PLOD2 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Plod2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PLOD2 mRNA CTD PMID:24780913 Plod2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLOD2 mRNA CTD PMID:30047161 Plod2 Rat acrylamide decreases expression ISO PLOD2 (Homo sapiens) 6480464 Acrylamide results in decreased expression of PLOD2 mRNA CTD PMID:32763439 Plod2 Rat aflatoxin B1 increases expression ISO Plod2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of PLOD2 mRNA CTD PMID:19770486 Plod2 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PLOD2 mRNA CTD PMID:33354967 Plod2 Rat aflatoxin B1 increases methylation ISO PLOD2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PLOD2 intron CTD PMID:30157460 Plod2 Rat aflatoxin B1 increases expression ISO PLOD2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PLOD2 mRNA CTD PMID:27153756 Plod2 Rat aflatoxin B1 decreases methylation ISO PLOD2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PLOD2 gene CTD PMID:27153756 Plod2 Rat aflatoxin M1 decreases expression ISO PLOD2 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of PLOD2 mRNA CTD PMID:30928695 Plod2 Rat aldehydo-D-glucose increases expression ISO Plod2 (Mus musculus) 6480464 Glucose results in increased expression of PLOD2 mRNA CTD PMID:17178593 Plod2 Rat all-trans-retinoic acid increases expression ISO PLOD2 (Homo sapiens) 6480464 Tretinoin results in increased expression of PLOD2 mRNA CTD PMID:17138961 and PMID:21934132 Plod2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLOD2 mRNA CTD PMID:30047161 Plod2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLOD2 mRNA CTD PMID:16483693 Plod2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PLOD2 mRNA CTD PMID:30779732 Plod2 Rat aristolochic acid A decreases expression ISO PLOD2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PLOD2 mRNA CTD PMID:33212167 Plod2 Rat arsane multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLOD2 mRNA CTD PMID:32525701 Plod2 Rat arsenic atom multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLOD2 mRNA CTD PMID:32525701 Plod2 Rat Azoxymethane multiple interactions ISO Plod2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLOD2 mRNA CTD PMID:29950665 Plod2 Rat benzo[a]pyrene increases expression ISO Plod2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PLOD2 mRNA CTD PMID:19770486 Plod2 Rat benzo[a]pyrene increases expression ISO PLOD2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLOD2 mRNA CTD PMID:32234424 Plod2 Rat benzo[a]pyrene decreases methylation ISO PLOD2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PLOD2 5' UTR and Benzo(a)pyrene results in decreased methylation of PLOD2 promoter CTD PMID:27901495 Plod2 Rat beta-lapachone decreases expression ISO PLOD2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PLOD2 mRNA CTD PMID:38218311 Plod2 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PLOD2 mRNA CTD PMID:18164116 Plod2 Rat beta-naphthoflavone decreases expression ISO PLOD2 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of PLOD2 mRNA CTD PMID:32858204 Plod2 Rat bexarotene increases expression ISO PLOD2 (Homo sapiens) 6480464 bexarotene results in increased expression of PLOD2 mRNA CTD PMID:17178900 Plod2 Rat bis(2-chloroethyl) sulfide increases expression ISO Plod2 (Mus musculus) 6480464 Mustard Gas results in increased expression of PLOD2 mRNA CTD PMID:15674844 Plod2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLOD2 mRNA CTD PMID:12075121 and PMID:25181051 Plod2 Rat bisphenol A multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PLOD2 gene CTD PMID:31601247 Plod2 Rat bisphenol A decreases methylation ISO PLOD2 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of PLOD2 gene CTD PMID:31601247 Plod2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLOD2 mRNA CTD PMID:34947998 Plod2 Rat bisphenol A increases expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol A results in increased expression of PLOD2 protein CTD PMID:37567409 Plod2 Rat bisphenol A affects expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol A affects the expression of PLOD2 mRNA CTD PMID:30903817 Plod2 Rat bisphenol A decreases expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLOD2 mRNA and bisphenol A results in decreased expression of PLOD2 protein CTD PMID:29275510 and PMID:34186270 Plod2 Rat bisphenol A increases expression ISO Plod2 (Mus musculus) 6480464 bisphenol A results in increased expression of PLOD2 mRNA CTD PMID:25594700 and PMID:30951980 Plod2 Rat bisphenol AF increases expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PLOD2 protein CTD PMID:34186270 Plod2 Rat Bisphenol B increases expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol B results in increased expression of PLOD2 protein CTD PMID:34186270 Plod2 Rat bisphenol F increases expression ISO Plod2 (Mus musculus) 6480464 bisphenol F results in increased expression of PLOD2 mRNA CTD PMID:30951980 Plod2 Rat bisphenol F increases expression ISO PLOD2 (Homo sapiens) 6480464 bisphenol F results in increased expression of PLOD2 protein CTD PMID:34186270 Plod2 Rat butan-1-ol multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PLOD2 mRNA CTD PMID:29432896 Plod2 Rat cadmium atom multiple interactions ISO PLOD2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PLOD2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PLOD2 protein CTD PMID:38195004 Plod2 Rat cadmium dichloride decreases expression ISO Plod2 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of PLOD2 mRNA CTD PMID:24982889 Plod2 Rat cadmium dichloride multiple interactions ISO PLOD2 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PLOD2 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PLOD2 protein CTD PMID:38195004 Plod2 Rat cadmium dichloride increases expression ISO PLOD2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PLOD2 mRNA CTD PMID:38568856 Plod2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PLOD2 mRNA CTD PMID:25993096 Plod2 Rat cadmium sulfate increases expression ISO PLOD2 (Homo sapiens) 6480464 cadmium sulfate results in increased expression of PLOD2 mRNA CTD PMID:12064557 and PMID:14676411 Plod2 Rat carbon nanotube decreases expression ISO Plod2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plod2 Rat CGP 52608 multiple interactions ISO PLOD2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PLOD2 gene] CTD PMID:28238834 Plod2 Rat chloropicrin affects expression ISO PLOD2 (Homo sapiens) 6480464 chloropicrin affects the expression of PLOD2 mRNA CTD PMID:26352163 Plod2 Rat chloropicrin decreases expression ISO PLOD2 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PLOD2 mRNA CTD PMID:28476498 Plod2 Rat choline multiple interactions ISO Plod2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of PLOD2 more ... CTD PMID:20938992 Plod2 Rat ciglitazone decreases expression EXP 6480464 ciglitazone results in decreased expression of PLOD2 mRNA CTD PMID:22193206 Plod2 Rat cisplatin multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PLOD2 mRNA CTD PMID:27392435 Plod2 Rat cisplatin decreases expression ISO PLOD2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of PLOD2 mRNA CTD PMID:27392435 Plod2 Rat cobalt atom multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of PLOD2 mRNA CTD PMID:20105288 Plod2 Rat cobalt dichloride increases expression ISO PLOD2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PLOD2 mRNA CTD PMID:19376846 and PMID:20105288 Plod2 Rat copper atom multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of PLOD2 mRNA and [NSC 689534 binds to Copper] which results in increased expression of PLOD2 mRNA CTD PMID:20971185 and PMID:24690739 Plod2 Rat copper(0) multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of PLOD2 mRNA and [NSC 689534 binds to Copper] which results in increased expression of PLOD2 mRNA CTD PMID:20971185 and PMID:24690739 Plod2 Rat copper(II) sulfate increases expression ISO PLOD2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PLOD2 mRNA CTD PMID:19549813 Plod2 Rat coumestrol multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Plod2 Rat curcumin multiple interactions ISO Plod2 (Mus musculus) 6480464 Curcumin inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of PLOD2 mRNA] CTD PMID:18200517 Plod2 Rat cyclosporin A affects expression ISO PLOD2 (Homo sapiens) 6480464 Cyclosporine affects the expression of PLOD2 mRNA CTD PMID:20106945 Plod2 Rat cyclosporin A decreases expression ISO PLOD2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PLOD2 mRNA CTD PMID:21632981 more ... Plod2 Rat cyclosporin A decreases expression ISO Plod2 (Mus musculus) 6480464 Cyclosporine results in decreased expression of PLOD2 mRNA CTD PMID:19770486 Plod2 Rat D-glucose increases expression ISO Plod2 (Mus musculus) 6480464 Glucose results in increased expression of PLOD2 mRNA CTD PMID:17178593 Plod2 Rat dexamethasone decreases expression ISO PLOD2 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PLOD2 mRNA CTD PMID:25047013 Plod2 Rat dextran sulfate multiple interactions ISO Plod2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLOD2 mRNA CTD PMID:29950665 Plod2 Rat diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of PLOD2 mRNA CTD PMID:34014027 Plod2 Rat dicrotophos decreases expression ISO PLOD2 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PLOD2 mRNA CTD PMID:28302478 Plod2 Rat dimethyl sulfoxide increases expression EXP 6480464 Dimethyl Sulfoxide results in increased expression of PLOD2 mRNA CTD PMID:22193206 Plod2 Rat dioxygen increases expression ISO PLOD2 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PLOD2 mRNA CTD PMID:20042640 more ... Plod2 Rat disulfiram multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of PLOD2 mRNA CTD PMID:24690739 Plod2 Rat dorsomorphin multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plod2 Rat doxifluridine decreases response to substance ISO PLOD2 (Homo sapiens) 6480464 PLOD2 protein results in decreased susceptibility to doxifluridine CTD PMID:16734730 Plod2 Rat doxorubicin decreases expression ISO PLOD2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLOD2 mRNA CTD PMID:29803840 Plod2 Rat elemental selenium decreases expression ISO PLOD2 (Homo sapiens) 6480464 Selenium results in decreased expression of PLOD2 mRNA CTD PMID:19244175 Plod2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PLOD2 mRNA CTD PMID:29391264 Plod2 Rat Enterolactone multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of PLOD2 mRNA CTD PMID:19167446 Plod2 Rat entinostat increases expression ISO PLOD2 (Homo sapiens) 6480464 entinostat results in increased expression of PLOD2 mRNA CTD PMID:26272509 Plod2 Rat entinostat multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat enzalutamide decreases expression ISO PLOD2 (Homo sapiens) 6480464 enzalutamide results in decreased expression of PLOD2 mRNA CTD PMID:29581250 Plod2 Rat ethanol increases expression ISO PLOD2 (Homo sapiens) 6480464 Ethanol results in increased expression of PLOD2 mRNA CTD PMID:15997088 and PMID:23378141 Plod2 Rat ethanol multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of PLOD2 mRNA and [Ethanol co-treated with Folic Acid] results in increased expression of PLOD2 mRNA CTD PMID:23378141 and PMID:29432896 Plod2 Rat ethanol multiple interactions ISO Plod2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PLOD2 mRNA CTD PMID:30517762 Plod2 Rat ethyl methanesulfonate decreases expression ISO PLOD2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of PLOD2 mRNA CTD PMID:23649840 Plod2 Rat folic acid multiple interactions ISO Plod2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of PLOD2 more ... CTD PMID:20938992 Plod2 Rat folic acid multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Ethanol co-treated with Folic Acid] results in increased expression of PLOD2 mRNA CTD PMID:23378141 Plod2 Rat fonofos increases methylation ISO PLOD2 (Homo sapiens) 6480464 Fonofos results in increased methylation of PLOD2 promoter CTD PMID:22847954 Plod2 Rat fulvestrant multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of PLOD2 gene CTD PMID:31601247 Plod2 Rat furan increases expression EXP 6480464 furan results in increased expression of PLOD2 mRNA CTD PMID:27387713 Plod2 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of PLOD2 gene CTD PMID:27387713 Plod2 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PLOD2 mRNA CTD PMID:12075121 Plod2 Rat glucose increases expression ISO Plod2 (Mus musculus) 6480464 Glucose results in increased expression of PLOD2 mRNA CTD PMID:17178593 Plod2 Rat isoniazide increases expression ISO PLOD2 (Homo sapiens) 6480464 Isoniazid results in increased expression of PLOD2 mRNA CTD PMID:15997088 Plod2 Rat ivermectin decreases expression ISO PLOD2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PLOD2 protein CTD PMID:32959892 Plod2 Rat L-methionine multiple interactions ISO Plod2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of PLOD2 more ... CTD PMID:20938992 Plod2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of PLOD2 mRNA CTD PMID:22641619 Plod2 Rat medroxyprogesterone acetate decreases expression ISO PLOD2 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in decreased expression of PLOD2 mRNA CTD PMID:20843944 Plod2 Rat mercury dibromide increases expression ISO PLOD2 (Homo sapiens) 6480464 mercuric bromide results in increased expression of PLOD2 mRNA CTD PMID:26272509 Plod2 Rat mercury dibromide multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PLOD2 mRNA CTD PMID:30047161 Plod2 Rat methyl methanesulfonate decreases expression ISO PLOD2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PLOD2 mRNA CTD PMID:23649840 Plod2 Rat methylmercury chloride increases expression ISO PLOD2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PLOD2 mRNA CTD PMID:23179753 and PMID:26272509 Plod2 Rat methylmercury chloride multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat methylmercury chloride decreases expression ISO PLOD2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat mifepristone increases expression ISO PLOD2 (Homo sapiens) 6480464 Mifepristone results in increased expression of PLOD2 mRNA CTD PMID:17584828 Plod2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of PLOD2 mRNA CTD PMID:18164116 Plod2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PLOD2 mRNA CTD PMID:25380136 Plod2 Rat nickel atom increases expression ISO PLOD2 (Homo sapiens) 6480464 Nickel results in increased expression of PLOD2 mRNA CTD PMID:24768652 Plod2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLOD2 mRNA CTD PMID:25729387 Plod2 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PLOD2 mRNA CTD PMID:25729387 Plod2 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PLOD2 mRNA CTD PMID:16716893 Plod2 Rat ozone multiple interactions ISO Plod2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PLOD2 mRNA CTD PMID:34911549 Plod2 Rat panobinostat multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat panobinostat increases expression ISO PLOD2 (Homo sapiens) 6480464 panobinostat results in increased expression of PLOD2 mRNA CTD PMID:26272509 Plod2 Rat paracetamol affects expression ISO Plod2 (Mus musculus) 6480464 Acetaminophen affects the expression of PLOD2 mRNA CTD PMID:17562736 Plod2 Rat paracetamol increases expression ISO Plod2 (Mus musculus) 6480464 Acetaminophen results in increased expression of PLOD2 mRNA CTD PMID:15997088 Plod2 Rat paracetamol increases expression ISO PLOD2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PLOD2 mRNA CTD PMID:15997088 Plod2 Rat paraquat affects splicing ISO Plod2 (Mus musculus) 6480464 Paraquat affects the splicing of PLOD2 exon CTD PMID:27111068 Plod2 Rat paraquat decreases expression ISO PLOD2 (Homo sapiens) 6480464 Paraquat results in decreased expression of PLOD2 protein CTD PMID:34064677 Plod2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PLOD2 mRNA CTD PMID:32680482 Plod2 Rat parathion increases methylation ISO PLOD2 (Homo sapiens) 6480464 Parathion results in increased methylation of PLOD2 promoter CTD PMID:22847954 Plod2 Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of PLOD2 mRNA CTD PMID:25710175 Plod2 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Plod2 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of PLOD2 protein CTD PMID:26178269 Plod2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PLOD2 mRNA CTD PMID:19162173 Plod2 Rat phenylmercury acetate increases expression ISO PLOD2 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PLOD2 mRNA CTD PMID:26272509 Plod2 Rat phenylmercury acetate multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat phosgene affects expression ISO Plod2 (Mus musculus) 6480464 Phosgene affects the expression of PLOD2 mRNA CTD PMID:16300373 Plod2 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PLOD2 mRNA CTD PMID:21770760 Plod2 Rat protein kinase inhibitor multiple interactions ISO PLOD2 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of PLOD2 mRNA] CTD PMID:28003376 Plod2 Rat quercetin decreases expression ISO PLOD2 (Homo sapiens) 6480464 Quercetin results in decreased expression of PLOD2 mRNA CTD PMID:21632981 Plod2 Rat rac-lactic acid decreases expression ISO PLOD2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PLOD2 mRNA CTD PMID:30851411 Plod2 Rat resveratrol multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of PLOD2 mRNA CTD PMID:19167446 Plod2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PLOD2 mRNA CTD PMID:28374803 Plod2 Rat Salinomycin decreases expression ISO PLOD2 (Homo sapiens) 6480464 salinomycin results in decreased expression of PLOD2 mRNA CTD PMID:19682730 Plod2 Rat SB 431542 multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plod2 Rat selenium atom decreases expression ISO PLOD2 (Homo sapiens) 6480464 Selenium results in decreased expression of PLOD2 mRNA CTD PMID:19244175 Plod2 Rat sodium arsenate decreases expression ISO Plod2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of PLOD2 mRNA CTD PMID:21795629 Plod2 Rat sodium arsenate multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of PLOD2 mRNA CTD PMID:32525701 Plod2 Rat sodium arsenate increases expression ISO Plod2 (Mus musculus) 6480464 sodium arsenate results in increased expression of PLOD2 mRNA CTD PMID:21795629 Plod2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PLOD2 mRNA CTD PMID:30047161 Plod2 Rat sunitinib increases expression ISO PLOD2 (Homo sapiens) 6480464 Sunitinib results in increased expression of PLOD2 mRNA CTD PMID:31533062 Plod2 Rat tamoxifen increases expression ISO Plod2 (Mus musculus) 6480464 Tamoxifen results in increased expression of PLOD2 mRNA CTD PMID:25123088 Plod2 Rat Tanshinone I decreases expression ISO PLOD2 (Homo sapiens) 6480464 tanshinone results in decreased expression of PLOD2 mRNA CTD PMID:15849732 Plod2 Rat temozolomide increases expression ISO PLOD2 (Homo sapiens) 6480464 Temozolomide results in increased expression of PLOD2 mRNA CTD PMID:31758290 Plod2 Rat terbufos increases methylation ISO PLOD2 (Homo sapiens) 6480464 terbufos results in increased methylation of PLOD2 promoter CTD PMID:22847954 Plod2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PLOD2 mRNA CTD PMID:32741896 Plod2 Rat testosterone enanthate affects expression ISO PLOD2 (Homo sapiens) 6480464 testosterone enanthate affects the expression of PLOD2 mRNA CTD PMID:17440010 Plod2 Rat tetrachloromethane affects expression ISO Plod2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PLOD2 mRNA CTD PMID:17484886 Plod2 Rat tetrachloromethane multiple interactions ISO Plod2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PLOD2 mRNA CTD PMID:30517762 Plod2 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PLOD2 mRNA CTD PMID:31150632 Plod2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PLOD2 mRNA CTD PMID:34492290 Plod2 Rat titanium dioxide multiple interactions ISO Plod2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLOD2 mRNA CTD PMID:29950665 Plod2 Rat titanium dioxide decreases methylation ISO Plod2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PLOD2 gene CTD PMID:35295148 Plod2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLOD2 mRNA CTD PMID:25729387 Plod2 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PLOD2 mRNA CTD PMID:25729387 Plod2 Rat topotecan affects response to substance ISO PLOD2 (Homo sapiens) 6480464 PLOD2 protein affects the susceptibility to Topotecan CTD PMID:16217747 Plod2 Rat trichostatin A increases expression ISO PLOD2 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLOD2 mRNA CTD PMID:24935251 and PMID:26272509 Plod2 Rat trichostatin A multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat triclosan decreases expression ISO PLOD2 (Homo sapiens) 6480464 Triclosan results in decreased expression of PLOD2 mRNA CTD PMID:30510588 Plod2 Rat tris(2-butoxyethyl) phosphate affects expression ISO PLOD2 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of PLOD2 mRNA CTD PMID:29024780 Plod2 Rat Tungsten carbide multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in increased expression of PLOD2 mRNA CTD PMID:20105288 Plod2 Rat valproic acid affects expression ISO PLOD2 (Homo sapiens) 6480464 Valproic Acid affects the expression of PLOD2 mRNA CTD PMID:25979313 Plod2 Rat valproic acid increases expression ISO PLOD2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLOD2 mRNA CTD PMID:23179753 more ... Plod2 Rat valproic acid multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat vandetanib increases expression ISO PLOD2 (Homo sapiens) 6480464 vandetanib results in increased expression of PLOD2 mRNA CTD PMID:16052530 Plod2 Rat vitamin E decreases expression ISO PLOD2 (Homo sapiens) 6480464 Vitamin E results in decreased expression of PLOD2 mRNA CTD PMID:19244175 Plod2 Rat vorinostat multiple interactions ISO PLOD2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLOD2 mRNA CTD PMID:27188386 Plod2 Rat vorinostat increases expression ISO PLOD2 (Homo sapiens) 6480464 vorinostat results in increased expression of PLOD2 mRNA CTD PMID:26272509 Plod2 Rat Yessotoxin increases expression ISO PLOD2 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of PLOD2 mRNA CTD PMID:30679557 Plod2 Rat zoledronic acid increases expression ISO PLOD2 (Homo sapiens) 6480464 zoledronic acid results in increased expression of PLOD2 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP,ISO) bexarotene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) choline (ISO) ciglitazone (EXP) cisplatin (ISO) cobalt atom (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) curcumin (ISO) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (EXP) dicrotophos (ISO) dimethyl sulfoxide (EXP) dioxygen (ISO) disulfiram (ISO) dorsomorphin (ISO) doxifluridine (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) enzalutamide (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) folic acid (ISO) fonofos (ISO) fulvestrant (ISO) furan (EXP) genistein (EXP) glucose (ISO) isoniazide (ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (EXP) medroxyprogesterone acetate (ISO) mercury dibromide (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mifepristone (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel atom (ISO) oxaliplatin (EXP) ozone (EXP,ISO) panobinostat (ISO) paracetamol (ISO) paraquat (EXP,ISO) parathion (ISO) pentane-2,3-dione (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) phosgene (ISO) progesterone (EXP) protein kinase inhibitor (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) Salinomycin (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenate (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) Tanshinone I (ISO) temozolomide (ISO) terbufos (ISO) testosterone (EXP) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP,ISO) trichostatin A (ISO) triclosan (ISO) tris(2-butoxyethyl) phosphate (ISO) Tungsten carbide (ISO) valproic acid (ISO) vandetanib (ISO) vitamin E (ISO) vorinostat (ISO) Yessotoxin (ISO) zoledronic acid (ISO)
Plod2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 101,964,318 - 102,047,022 (+) NCBI GRCr8 mRatBN7.2 8 93,084,548 - 93,167,255 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 93,084,513 - 93,167,255 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 98,757,951 - 98,827,969 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 96,957,203 - 97,027,220 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 94,787,446 - 94,864,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 99,977,334 - 100,059,736 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 99,977,334 - 100,059,736 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 99,462,925 - 99,529,696 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 8 99,543,695 - 99,545,578 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 97,525,279 - 97,623,152 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 97,544,733 - 97,642,604 (+) NCBI Celera 8 92,602,361 - 92,678,608 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
PLOD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 146,069,440 - 146,161,184 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 146,035,139 - 146,163,725 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 145,787,227 - 145,878,971 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 147,269,917 - 147,361,972 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 144,204,566 - 144,296,620 (-) NCBI Celera Cytogenetic Map 3 q24 NCBI HuRef 3 143,164,166 - 143,256,088 (-) NCBI HuRef CHM1_1 3 145,750,160 - 145,842,267 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 148,824,992 - 148,916,735 (-) NCBI T2T-CHM13v2.0
Plod2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 92,421,828 - 92,490,481 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 92,424,276 - 92,490,481 (+) Ensembl GRCm39 Ensembl GRCm38 9 92,539,636 - 92,608,428 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 92,542,223 - 92,608,428 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 92,437,061 - 92,503,266 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 92,346,223 - 92,412,195 (+) NCBI MGSCv36 mm8 Celera 9 92,126,694 - 92,192,758 (+) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 48.4 NCBI
Plod2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955474 11,392,163 - 11,475,508 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955474 11,392,163 - 11,473,918 (+) NCBI ChiLan1.0 ChiLan1.0
PLOD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 143,960,509 - 144,050,676 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 143,965,240 - 144,055,393 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 143,091,833 - 143,181,831 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 150,675,423 - 150,764,939 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 150,675,424 - 150,764,939 (-) Ensembl panpan1.1 panPan2
PLOD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 41,290,183 - 41,382,917 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 41,290,567 - 41,382,807 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 ROS_Cfam_1.0 23 41,914,649 - 42,007,609 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 41,915,768 - 42,007,611 (-) Ensembl ROS_Cfam_1.0 Ensembl
Plod2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 80,594,496 - 80,680,880 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936519 9,053,033 - 9,140,059 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936519 9,053,192 - 9,139,221 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLOD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 86,401,244 - 86,513,105 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 86,402,673 - 86,513,167 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 94,175,156 - 94,243,446 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLOD2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 44,489,804 - 44,590,284 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 44,490,042 - 44,591,526 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 17,375,187 - 17,466,565 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plod2
.
Predicted Target Of
Count of predictions: 266 Count of miRNA genes: 133 Interacting mature miRNAs: 146 Transcripts: ENSRNOT00000041859, ENSRNOT00000056704 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH130034
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 93,166,948 - 93,167,128 (+) MAPPER mRatBN7.2 Rnor_6.0 8 100,059,430 - 100,059,609 NCBI Rnor6.0 Rnor_5.0 8 99,545,272 - 99,545,451 UniSTS Rnor5.0 RGSC_v3.4 8 97,622,846 - 97,623,025 UniSTS RGSC3.4 Celera 8 92,678,302 - 92,678,481 UniSTS RH 3.4 Map 8 1039.6 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041859 ⟹ ENSRNOP00000047828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 93,084,513 - 93,167,251 (+) Ensembl Rnor_6.0 Ensembl 8 99,977,334 - 100,059,736 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000056704 ⟹ ENSRNOP00000053546
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 93,084,546 - 93,167,255 (+) Ensembl Rnor_6.0 Ensembl 8 99,977,334 - 100,059,736 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000085808 ⟹ ENSRNOP00000069407
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 8 99,977,334 - 100,059,728 (+) Ensembl
RefSeq Acc Id:
NM_001142915 ⟹ NP_001136387
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 101,964,318 - 102,047,022 (+) NCBI mRatBN7.2 8 93,084,548 - 93,167,255 (+) NCBI Rnor_6.0 8 99,977,334 - 100,059,736 (+) NCBI Rnor_5.0 8 99,462,925 - 99,529,696 (+) NCBI Rnor_5.0 8 99,543,695 - 99,545,578 (+) NCBI RGSC_v3.4 8 97,525,279 - 97,623,152 (+) RGD Celera 8 92,602,361 - 92,678,608 (+) RGD
Sequence:
TTCCGTCGTCTGCTCGGTGCGCTCGGGCTCCGCGCTAGTCCGCTCAGTGTTCTCCAATCGCTTTGGTACCCACGCAGTCCTCTCATCCGTCCTCCGCTGCCGTCCCGGGCCCCACGTCTAACCCGGTG
hide sequence
RefSeq Acc Id:
NM_175869 ⟹ NP_787065
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 101,964,318 - 102,047,022 (+) NCBI mRatBN7.2 8 93,084,548 - 93,167,255 (+) NCBI Rnor_6.0 8 99,977,334 - 100,059,736 (+) NCBI Rnor_5.0 8 99,462,925 - 99,529,696 (+) NCBI Rnor_5.0 8 99,543,695 - 99,545,578 (+) NCBI RGSC_v3.4 8 97,525,279 - 97,623,152 (+) RGD Celera 8 92,602,361 - 92,678,608 (+) RGD
Sequence:
TTCCGTCGTCTGCTCGGTGCGCTCGGGCTCCGCGCTAGTCCGCTCAGTGTTCTCCAATCGCTTT
hide sequence
RefSeq Acc Id:
NP_787065 ⟸ NM_175869
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q811A4 (UniProtKB/Swiss-Prot), Q811A3 (UniProtKB/Swiss-Prot), A6I244 (UniProtKB/TrEMBL), D3ZQR7 (UniProtKB/TrEMBL)
- Sequence:
MGDRGVRLGLLMPMLALLSWAASLGVAEETPSRIPADKLLVITVATKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLMKEAMEHYAGQDDLVILFTECFDVIFAGGPEELLKK
hide sequence
RefSeq Acc Id:
NP_001136387 ⟸ NM_001142915
- Peptide Label:
isoform 2 precursor
- UniProtKB:
Q811A4 (UniProtKB/Swiss-Prot), Q811A3 (UniProtKB/Swiss-Prot), A6I245 (UniProtKB/TrEMBL), G3V9I0 (UniProtKB/TrEMBL)
- Sequence:
MGDRGVRLGLLMPMLALLSWAASLGVAEETPSRIPADKLLVITVATKENDGFHRFMNSAKYFNYTVKVLGQGQEWRGGDGMNSIGGGQKVRLMKEAMEHYAGQDDLVILFTECFDVIFAGGPEELLKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000047828 ⟸ ENSRNOT00000041859
Ensembl Acc Id:
ENSRNOP00000053546 ⟸ ENSRNOT00000056704
Ensembl Acc Id:
ENSRNOP00000069407 ⟸ ENSRNOT00000085808
RGD ID: 13696182 Promoter ID: EPDNEW_R6707 Type: multiple initiation site Name: Plod2_1 Description: procollagen lysine, 2-oxoglutarate 5-dioxygenase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 99,977,336 - 99,977,396 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Plod2
procollagen lysine, 2-oxoglutarate 5-dioxygenase 2
Procollagen-lysine, 2-oxoglutarate 5-dioxygenase (Lysine hydroxylase) 2
Name updated
625702 APPROVED
2002-06-10
Plod2
Procollagen-lysine, 2-oxoglutarate 5-dioxygenase (Lysine hydroxylase) 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
mRNA is highly induced in a time-dependent manner by hypoxia in vascular smooth muscle cell line A7r5
1303932
gene_function
indispensible for collagen fiber formation
1303932
gene_homology
human homologue PLOD2 is an important enzyme in fibrotic processes
1303933
gene_transcript
expression during hypoxia may be regulated by hypoxia-inducible transcription factor 1 (HIF-1), a binding site of which is located in the promoter region
1303932
