Symbol:
Pgam1
Name:
phosphoglycerate mutase 1
RGD ID:
3312
Description:
Enables phosphoglycerate mutase activity. Predicted to be involved in canonical glycolysis and gluconeogenesis. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to several human genes including PGAM1 (phosphoglycerate mutase 1); PARTICIPATES IN Fanconi syndrome pathway; fructose-1,6-bisphosphatase deficiency pathway; gluconeogenesis pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
BPG-dependent PGAM 1; PGAM-B; Pgmut; phosphoglycerate mutase 1 (brain); phosphoglycerate mutase 1 reserved symbol; phosphoglycerate mutase isozyme B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PGAM1 (phosphoglycerate mutase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Pgam1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pgam1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PGAM1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PGAM1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pgam1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PGAM1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PGAM1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pgam1 (phosphoglycerate mutase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PGAM4 (phosphoglycerate mutase family member 4) HGNC
EggNOG, Ensembl, Panther
Homo sapiens (human):
PGAM2 (phosphoglycerate mutase 2) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Pgam1 (phosphoglycerate mutase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PGAM1 (phosphoglycerate mutase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PGAM4 (phosphoglycerate mutase family member 4)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
pgam1b (phosphoglycerate mutase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
pgam1a (phosphoglycerate mutase 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7059
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
GPM1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pglym78
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Pglym87
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pgam1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 250,673,152 - 250,680,762 (+) NCBI GRCr8 mRatBN7.2 1 240,723,832 - 240,731,443 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 240,723,920 - 240,738,452 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 248,868,982 - 248,876,729 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 255,566,135 - 255,573,881 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 248,219,147 - 248,226,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 261,158,204 - 261,165,814 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 261,158,261 - 261,165,808 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 268,610,733 - 268,618,280 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 236,559,231 - 236,566,463 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pgam1 Rat (1->4)-beta-D-glucan multiple interactions ISO Pgam1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGAM1 mRNA CTD PMID:36331819 Pgam1 Rat 1,2-dimethylhydrazine decreases expression ISO Pgam1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PGAM1 mRNA CTD PMID:22206623 Pgam1 Rat 1,2-dimethylhydrazine multiple interactions ISO Pgam1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PGAM1 mRNA CTD PMID:22206623 Pgam1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PGAM1 mRNA CTD PMID:32145629 Pgam1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PGAM1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGAM1 mRNA CTD PMID:21802500 Pgam1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PGAM1 mRNA CTD PMID:32109520 more ... Pgam1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PGAM1 protein CTD PMID:15822908 Pgam1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pgam1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PGAM1 mRNA CTD PMID:21570461 Pgam1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of PGAM1 protein CTD PMID:19033394 Pgam1 Rat 2-methylcholine affects expression ISO PGAM1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of PGAM1 mRNA CTD PMID:21179406 Pgam1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of PGAM1 mRNA CTD PMID:19162173 Pgam1 Rat 4,4'-sulfonyldiphenol increases expression ISO Pgam1 (Mus musculus) 6480464 bisphenol S results in increased expression of PGAM1 mRNA CTD PMID:39298647 Pgam1 Rat 4,4'-sulfonyldiphenol increases expression ISO PGAM1 (Homo sapiens) 6480464 bisphenol S results in increased expression of PGAM1 protein CTD PMID:34186270 Pgam1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PGAM1 mRNA CTD PMID:30047161 Pgam1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PGAM1 mRNA CTD PMID:24780913 Pgam1 Rat actinomycin D multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PGAM1 protein CTD PMID:38460933 Pgam1 Rat all-trans-retinoic acid increases expression ISO PGAM1 (Homo sapiens) 6480464 Tretinoin results in increased expression of PGAM1 mRNA CTD PMID:33167477 Pgam1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PGAM1 mRNA CTD PMID:30047161 Pgam1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PGAM1 mRNA CTD PMID:16483693 Pgam1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PGAM1 mRNA CTD PMID:30779732 Pgam1 Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PGAM1 protein CTD PMID:30545405 Pgam1 Rat aristolochic acid A increases expression ISO PGAM1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PGAM1 protein CTD PMID:33212167 Pgam1 Rat arsenite(3-) decreases expression EXP 6480464 arsenite results in decreased expression of PGAM1 protein CTD PMID:21344382 Pgam1 Rat atrazine increases expression ISO PGAM1 (Homo sapiens) 6480464 Atrazine results in increased expression of PGAM1 mRNA CTD PMID:22378314 Pgam1 Rat Azaspiracid increases expression ISO PGAM1 (Homo sapiens) 6480464 azaspiracid results in increased expression of PGAM1 mRNA CTD PMID:28939011 Pgam1 Rat beauvericin multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PGAM1 protein CTD PMID:32407736 Pgam1 Rat benzbromarone affects expression EXP 6480464 Benzbromarone affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat benzo[a]pyrene decreases expression ISO PGAM1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PGAM1 mRNA CTD PMID:21802500 Pgam1 Rat benzo[a]pyrene affects methylation ISO PGAM1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PGAM1 promoter CTD PMID:27901495 Pgam1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PGAM1 protein CTD PMID:16456883 Pgam1 Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of PGAM1 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in increased expression of PGAM1 protein] CTD PMID:16456883 Pgam1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO PGAM1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PGAM1 mRNA CTD PMID:28412506 Pgam1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Pgam1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of PGAM1 mRNA CTD PMID:33754040 Pgam1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PGAM1 mRNA CTD PMID:25181051 and PMID:32145629 Pgam1 Rat bisphenol A multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat bisphenol A decreases expression ISO Pgam1 (Mus musculus) 6480464 bisphenol A results in decreased expression of PGAM1 protein CTD PMID:35999755 Pgam1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PGAM1 protein CTD PMID:32145629 Pgam1 Rat bisphenol A decreases expression ISO PGAM1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PGAM1 mRNA and bisphenol A results in decreased expression of PGAM1 protein CTD PMID:29275510 more ... Pgam1 Rat bisphenol A affects expression ISO PGAM1 (Homo sapiens) 6480464 bisphenol A affects the expression of PGAM1 mRNA CTD PMID:30903817 Pgam1 Rat bisphenol AF increases expression ISO PGAM1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PGAM1 protein CTD PMID:34186270 Pgam1 Rat Bisphenol B increases expression ISO PGAM1 (Homo sapiens) 6480464 bisphenol B results in increased expression of PGAM1 protein CTD PMID:34186270 Pgam1 Rat bisphenol F increases expression ISO Pgam1 (Mus musculus) 6480464 bisphenol F results in increased expression of PGAM1 mRNA CTD PMID:38685157 Pgam1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PGAM1 protein CTD PMID:28903499 Pgam1 Rat Butylbenzyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat cadmium acetate multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PGAM1 mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PGAM1 mRNA] CTD PMID:33404196 Pgam1 Rat cadmium atom multiple interactions EXP 6480464 [cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PGAM1 mRNA and puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PGAM1 mRNA] CTD PMID:33404196 Pgam1 Rat cadmium atom multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PGAM1 mRNA CTD PMID:35301059 Pgam1 Rat cadmium dichloride increases expression ISO PGAM1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PGAM1 protein CTD PMID:24527689 Pgam1 Rat cadmium dichloride multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PGAM1 mRNA CTD PMID:35301059 Pgam1 Rat cadmium dichloride decreases expression ISO PGAM1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PGAM1 mRNA CTD PMID:38568856 Pgam1 Rat calycosin increases expression ISO PGAM1 (Homo sapiens) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone results in increased expression of PGAM1 protein CTD PMID:24455688 Pgam1 Rat carbon nanotube affects expression ISO PGAM1 (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of PGAM1 protein CTD PMID:22001959 Pgam1 Rat carbon nanotube increases expression ISO Pgam1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Pgam1 Rat carbon nanotube decreases expression ISO Pgam1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PGAM1 mRNA CTD PMID:25620056 Pgam1 Rat carbon nanotube affects expression ISO Pgam1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of PGAM1 protein CTD PMID:21135415 Pgam1 Rat celastrol multiple interactions ISO Pgam1 (Mus musculus) 6480464 celastrol inhibits the reaction [Dietary Fats results in decreased expression of PGAM1 mRNA] CTD PMID:35679966 Pgam1 Rat celastrol increases expression ISO Pgam1 (Mus musculus) 6480464 celastrol results in increased expression of PGAM1 mRNA CTD PMID:35679966 Pgam1 Rat CGP 52608 multiple interactions ISO PGAM1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PGAM1 gene] CTD PMID:28238834 Pgam1 Rat chlorophyllin decreases expression ISO PGAM1 (Homo sapiens) 6480464 chlorophyllin analog results in decreased expression of PGAM1 protein CTD PMID:22852132 Pgam1 Rat chloropicrin affects expression ISO PGAM1 (Homo sapiens) 6480464 chloropicrin affects the expression of PGAM1 mRNA CTD PMID:26352163 Pgam1 Rat chloropicrin decreases expression ISO PGAM1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of PGAM1 mRNA CTD PMID:28476498 Pgam1 Rat chlorpyrifos increases expression ISO Pgam1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PGAM1 mRNA CTD PMID:37019170 Pgam1 Rat clobetasol increases expression ISO Pgam1 (Mus musculus) 6480464 Clobetasol results in increased expression of PGAM1 mRNA CTD PMID:27462272 Pgam1 Rat clofibrate affects expression EXP 6480464 Clofibrate affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PGAM1 mRNA CTD PMID:17602206 Pgam1 Rat copper atom affects binding ISO PGAM1 (Homo sapiens) 6480464 PGAM1 protein binds to Copper CTD PMID:15359738 Pgam1 Rat copper(0) affects binding ISO PGAM1 (Homo sapiens) 6480464 PGAM1 protein binds to Copper CTD PMID:15359738 Pgam1 Rat copper(II) chloride increases expression ISO Pgam1 (Mus musculus) 6480464 cupric chloride results in increased expression of PGAM1 protein CTD PMID:29617964 Pgam1 Rat copper(II) sulfate decreases expression ISO PGAM1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PGAM1 mRNA CTD PMID:19549813 Pgam1 Rat dextran sulfate decreases expression ISO Pgam1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of PGAM1 protein CTD PMID:35999755 Pgam1 Rat Di-n-octyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat dibutyl phthalate decreases expression ISO Pgam1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PGAM1 mRNA CTD PMID:17361019 and PMID:21266533 Pgam1 Rat dibutyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PGAM1 mRNA CTD PMID:17379624 and PMID:21266533 Pgam1 Rat diethyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat Diisodecyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat diisononyl phthalate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with diethyl phthalate co-treated with diisononyl phthalate co-treated with di-n-octyl phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisodecyl phthalate] results in decreased expression of PGAM1 mRNA CTD PMID:37364641 Pgam1 Rat dioxygen increases expression ISO Pgam1 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PGAM1 mRNA CTD PMID:20880076 Pgam1 Rat enniatin multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in increased expression of PGAM1 protein CTD PMID:32407736 Pgam1 Rat enzyme inhibitor multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PGAM1 protein CTD PMID:23301498 Pgam1 Rat epoxiconazole decreases expression ISO Pgam1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PGAM1 mRNA CTD PMID:35436446 Pgam1 Rat ethanol increases expression ISO Pgam1 (Mus musculus) 6480464 Ethanol results in increased expression of PGAM1 mRNA CTD PMID:19167417 Pgam1 Rat ethanol multiple interactions ISO Pgam1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of PGAM1 mRNA CTD PMID:30319688 Pgam1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PGAM1 mRNA CTD PMID:15353170 Pgam1 Rat fenthion increases expression ISO Pgam1 (Mus musculus) 6480464 Fenthion results in increased expression of PGAM1 mRNA CTD PMID:34813904 Pgam1 Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of PGAM1 protein CTD PMID:33656234 Pgam1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of PGAM1 mRNA CTD PMID:34044035 Pgam1 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PGAM1 mRNA CTD PMID:18035473 Pgam1 Rat fluoranthene multiple interactions ISO Pgam1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of PGAM1 mRNA CTD PMID:28329830 Pgam1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PGAM1 mRNA and Flutamide results in increased expression of PGAM1 protein CTD PMID:17311803 and PMID:24136188 Pgam1 Rat folic acid multiple interactions ISO Pgam1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PGAM1 mRNA CTD PMID:22206623 Pgam1 Rat furfural multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PGAM1 protein CTD PMID:38598786 Pgam1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PGAM1 mRNA CTD PMID:22061828 Pgam1 Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PGAM1 protein CTD PMID:30545405 Pgam1 Rat hyaluronic acid multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PGAM1 protein] CTD PMID:23178681 Pgam1 Rat hydrogen peroxide multiple interactions EXP 6480464 Hyaluronic Acid analog inhibits the reaction [Hydrogen Peroxide results in decreased expression of PGAM1 protein] CTD PMID:23178681 Pgam1 Rat hydrogen peroxide decreases expression EXP 6480464 Hydrogen Peroxide results in decreased expression of PGAM1 protein CTD PMID:23178681 Pgam1 Rat ibuprofen affects expression ISO PGAM1 (Homo sapiens) 6480464 Ibuprofen affects the expression of PGAM1 protein CTD PMID:18351690 Pgam1 Rat ibuprofen increases expression ISO PGAM1 (Homo sapiens) 6480464 Ibuprofen results in increased expression of PGAM1 mRNA CTD PMID:18351690 Pgam1 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of PGAM1 mRNA CTD PMID:36868495 Pgam1 Rat ivermectin decreases expression ISO PGAM1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PGAM1 protein CTD PMID:32959892 Pgam1 Rat L-ethionine affects expression EXP 6480464 Ethionine affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat lead(0) decreases expression ISO PGAM1 (Homo sapiens) 6480464 Lead results in decreased expression of PGAM1 mRNA CTD PMID:19921347 Pgam1 Rat lipopolysaccharide multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PGAM1 mRNA CTD PMID:35877022 Pgam1 Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of PGAM1 protein CTD PMID:18296634 Pgam1 Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of PGAM1 protein CTD PMID:18296634 Pgam1 Rat lovastatin decreases expression ISO Pgam1 (Mus musculus) 6480464 Lovastatin results in decreased expression of PGAM1 mRNA CTD PMID:20493250 Pgam1 Rat lovastatin increases expression ISO Pgam1 (Mus musculus) 6480464 Lovastatin results in increased expression of PGAM1 mRNA CTD PMID:20493250 Pgam1 Rat methamphetamine multiple interactions ISO Pgam1 (Mus musculus) 6480464 (1R-(exo more ... CTD PMID:11756511 Pgam1 Rat methamphetamine increases expression ISO Pgam1 (Mus musculus) 6480464 Methamphetamine results in increased expression of PGAM1 mRNA CTD PMID:36914120 Pgam1 Rat methamphetamine decreases expression ISO Pgam1 (Mus musculus) 6480464 Methamphetamine results in decreased expression of PGAM1 mRNA CTD PMID:11756511 Pgam1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of PGAM1 mRNA CTD PMID:28903497 Pgam1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PGAM1 mRNA CTD PMID:30047161 Pgam1 Rat methotrexate decreases expression ISO PGAM1 (Homo sapiens) 6480464 Methotrexate results in decreased expression of PGAM1 mRNA and Methotrexate results in decreased expression of PGAM1 protein CTD PMID:24736981 Pgam1 Rat methyl methanesulfonate decreases expression ISO PGAM1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PGAM1 mRNA CTD PMID:23649840 Pgam1 Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PGAM1 protein CTD PMID:30545405 Pgam1 Rat miconazole increases expression ISO Pgam1 (Mus musculus) 6480464 Miconazole results in increased expression of PGAM1 mRNA CTD PMID:27462272 Pgam1 Rat microcystin RR decreases expression ISO PGAM1 (Homo sapiens) 6480464 microcystin RR results in decreased expression of PGAM1 protein CTD PMID:19111056 Pgam1 Rat monosodium L-glutamate multiple interactions ISO Pgam1 (Mus musculus) 6480464 [Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of PGAM1 mRNA CTD PMID:22078008 Pgam1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Pgam1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PGAM1 mRNA CTD PMID:17475336 and PMID:22776087 Pgam1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PGAM1 mRNA more ... CTD PMID:17602206 and PMID:25374375 Pgam1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PGAM1 mRNA CTD PMID:24136188 Pgam1 Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PGAM1 protein CTD PMID:30545405 Pgam1 Rat Nutlin-3 multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PGAM1 protein CTD PMID:38460933 Pgam1 Rat okadaic acid multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Okadaic Acid co-treated with gambierol] results in decreased expression of PGAM1 protein CTD PMID:19397276 Pgam1 Rat omeprazole affects expression EXP 6480464 Omeprazole affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PGAM1 mRNA CTD PMID:25838073 Pgam1 Rat ozone multiple interactions ISO Pgam1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of PGAM1 mRNA CTD PMID:34911549 Pgam1 Rat ozone increases expression ISO Pgam1 (Mus musculus) 6480464 Ozone results in increased expression of PGAM1 mRNA CTD PMID:33026818 Pgam1 Rat paracetamol affects expression ISO Pgam1 (Mus musculus) 6480464 Acetaminophen affects the expression of PGAM1 mRNA CTD PMID:17562736 Pgam1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PGAM1 mRNA CTD PMID:33387578 Pgam1 Rat paracetamol multiple interactions ISO Pgam1 (Mus musculus) 6480464 [CTH gene mutant form results in increased susceptibility to Acetaminophen] which results in decreased expression of PGAM1 protein CTD PMID:25499718 Pgam1 Rat paraquat increases expression ISO Pgam1 (Mus musculus) 6480464 Paraquat results in increased expression of PGAM1 mRNA and Paraquat results in increased expression of PGAM1 protein CTD PMID:27111068 Pgam1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pgam1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGAM1 mRNA CTD PMID:36331819 Pgam1 Rat perfluorooctanoic acid decreases expression ISO PGAM1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PGAM1 mRNA CTD PMID:36326898 Pgam1 Rat phenobarbital affects expression ISO PGAM1 (Homo sapiens) 6480464 Phenobarbital affects the expression of PGAM1 mRNA CTD PMID:19159669 Pgam1 Rat phenobarbital increases expression ISO Pgam1 (Mus musculus) 6480464 Phenobarbital results in increased expression of PGAM1 mRNA CTD PMID:31836555 Pgam1 Rat phenobarbital multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in decreased methylation of PGAM1 promoter and [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of PGAM1 mRNA CTD PMID:25374375 Pgam1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PGAM1 mRNA CTD PMID:19162173 Pgam1 Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of PGAM1 mRNA CTD PMID:15170462 Pgam1 Rat pirinixic acid increases expression ISO Pgam1 (Mus musculus) 6480464 pirinixic acid results in increased expression of PGAM1 mRNA CTD PMID:18301758 Pgam1 Rat pirinixic acid affects expression EXP 6480464 pirinixic acid affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat potassium chromate increases expression ISO PGAM1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PGAM1 mRNA CTD PMID:22714537 Pgam1 Rat promethazine increases expression EXP 6480464 Promethazine results in increased expression of PGAM1 mRNA CTD PMID:28903497 Pgam1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PGAM1 mRNA CTD PMID:30047161 Pgam1 Rat pterostilbene decreases expression ISO PGAM1 (Homo sapiens) 6480464 pterostilbene results in decreased expression of PGAM1 protein CTD PMID:24936659 Pgam1 Rat puerarin multiple interactions EXP 6480464 puerarin inhibits the reaction [[cadmium acetate results in increased abundance of Cadmium] which results in decreased expression of PGAM1 mRNA] CTD PMID:33404196 Pgam1 Rat quercetin increases expression ISO PGAM1 (Homo sapiens) 6480464 Quercetin results in increased expression of PGAM1 protein CTD PMID:17292933 Pgam1 Rat quercetin increases phosphorylation ISO PGAM1 (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of PGAM1 protein CTD PMID:35688186 Pgam1 Rat resveratrol decreases expression ISO PGAM1 (Homo sapiens) 6480464 resveratrol results in decreased expression of PGAM1 mRNA and resveratrol results in decreased expression of PGAM1 protein CTD PMID:15582268 and PMID:16979140 Pgam1 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of PGAM1 mRNA CTD PMID:12818353 Pgam1 Rat silicon dioxide increases secretion ISO PGAM1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased secretion of PGAM1 protein CTD PMID:25895662 Pgam1 Rat sodium arsenite increases expression ISO PGAM1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PGAM1 mRNA and sodium arsenite results in increased expression of PGAM1 protein CTD PMID:15899475 more ... Pgam1 Rat sodium arsenite decreases expression ISO PGAM1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PGAM1 mRNA CTD PMID:38568856 Pgam1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PGAM1 protein CTD PMID:29459688 Pgam1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PGAM1 protein CTD PMID:16456883 Pgam1 Rat sodium arsenite multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [sodium arsenite results in increased expression of PGAM1 protein] and sodium arsenite promotes the reaction [Benzo(a)pyrene results in increased expression of PGAM1 protein] CTD PMID:16456883 Pgam1 Rat sodium chloride multiple interactions ISO PGAM1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PGAM1 protein CTD PMID:38598786 Pgam1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PGAM1 mRNA CTD PMID:30047161 Pgam1 Rat sulindac sulfide decreases expression ISO PGAM1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PGAM1 mRNA CTD PMID:12734198 Pgam1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of PGAM1 protein CTD PMID:26141394 Pgam1 Rat thapsigargin decreases expression ISO PGAM1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PGAM1 mRNA CTD PMID:22378314 Pgam1 Rat thimerosal decreases expression ISO PGAM1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of PGAM1 mRNA CTD PMID:27188386 Pgam1 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of PGAM1 mRNA CTD PMID:19483382 Pgam1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PGAM1 mRNA CTD PMID:28903497 and PMID:34492290 Pgam1 Rat thiram decreases expression ISO PGAM1 (Homo sapiens) 6480464 Thiram results in decreased expression of PGAM1 mRNA CTD PMID:38568856 Pgam1 Rat titanium dioxide increases methylation ISO Pgam1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of PGAM1 promoter CTD PMID:35295148 Pgam1 Rat titanium dioxide decreases methylation ISO Pgam1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PGAM1 gene CTD PMID:35295148 Pgam1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PGAM1 mRNA CTD PMID:19448997 Pgam1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PGAM1 mRNA CTD PMID:33387578 Pgam1 Rat trimellitic anhydride increases expression ISO Pgam1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PGAM1 mRNA CTD PMID:19042947 Pgam1 Rat triphenyl phosphate affects expression ISO PGAM1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PGAM1 mRNA CTD PMID:37042841 Pgam1 Rat tunicamycin decreases expression ISO PGAM1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PGAM1 mRNA CTD PMID:22378314 and PMID:29453283 Pgam1 Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PGAM1 protein CTD PMID:30545405 Pgam1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of PGAM1 gene CTD PMID:31682807 Pgam1 Rat warfarin decreases expression ISO Pgam1 (Mus musculus) 6480464 Warfarin results in decreased expression of PGAM1 mRNA CTD PMID:20493250 Pgam1 Rat warfarin increases expression ISO Pgam1 (Mus musculus) 6480464 Warfarin results in increased expression of PGAM1 mRNA CTD PMID:20493250 Pgam1 Rat Yessotoxin increases expression ISO PGAM1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of PGAM1 mRNA CTD PMID:30679557
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 2-methylcholine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) 6-propyl-2-thiouracil (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) ampicillin (EXP) aristolochic acid A (ISO) arsenite(3-) (EXP) atrazine (ISO) Azaspiracid (ISO) beauvericin (ISO) benzbromarone (EXP) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) Butylbenzyl phthalate (ISO) cadmium acetate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (ISO) calycosin (ISO) carbon nanotube (ISO) celastrol (ISO) CGP 52608 (ISO) chlorophyllin (ISO) chloropicrin (ISO) chlorpyrifos (ISO) clobetasol (ISO) clofibrate (EXP) clofibric acid (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) dextran sulfate (ISO) Di-n-octyl phthalate (ISO) dibutyl phthalate (EXP,ISO) diethyl phthalate (ISO) Diisodecyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) enniatin (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) fenthion (ISO) fenvalerate (EXP) fipronil (EXP) flavonoids (EXP) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) hyaluronic acid (EXP) hydrogen peroxide (EXP) ibuprofen (ISO) indometacin (EXP) ivermectin (ISO) L-ethionine (EXP) lead(0) (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) lovastatin (ISO) methamphetamine (ISO) methapyrilene (EXP) methimazole (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) metronidazole (EXP) miconazole (ISO) microcystin RR (ISO) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) neomycin (EXP) Nutlin-3 (ISO) okadaic acid (ISO) omeprazole (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) picrotoxin (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) promethazine (EXP) propiconazole (EXP) pterostilbene (ISO) puerarin (EXP) quercetin (ISO) resveratrol (ISO) scopolamine (EXP) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sulfadimethoxine (EXP) sulindac sulfide (ISO) T-2 toxin (EXP) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) vancomycin (EXP) vinclozolin (EXP) warfarin (ISO) Yessotoxin (ISO)
1.
Nuclear location of phosphoglycerate mutase BB isozyme in rat tissues.
Egea G, etal., Histochemistry. 1992;97(3):269-75.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
The histidine phosphatase superfamily: structure and function.
Rigden DJ Biochem J. 2008 Jan 15;409(2):333-48.
11.
Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Isolation and sequencing of a cDNA encoding the B isozyme of rat phosphoglycerate mutase.
Urena JM, etal., Gene 1992 Apr 15;113(2):281-2.
Pgam1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 250,673,152 - 250,680,762 (+) NCBI GRCr8 mRatBN7.2 1 240,723,832 - 240,731,443 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 240,723,920 - 240,738,452 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 248,868,982 - 248,876,729 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 255,566,135 - 255,573,881 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 248,219,147 - 248,226,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 261,158,204 - 261,165,814 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 261,158,261 - 261,165,808 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 268,610,733 - 268,618,280 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 236,559,231 - 236,566,463 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
PGAM1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 97,426,191 - 97,433,444 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 97,426,191 - 97,433,444 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 99,185,948 - 99,193,201 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 99,176,017 - 99,183,188 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 99,176,016 - 99,183,187 NCBI Celera 10 92,924,180 - 92,931,355 (+) NCBI Celera Cytogenetic Map 10 q24.1 NCBI HuRef 10 92,811,681 - 92,818,852 (+) NCBI HuRef CHM1_1 10 99,467,767 - 99,474,938 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 98,306,372 - 98,313,625 (+) NCBI T2T-CHM13v2.0
Pgam1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 41,900,310 - 41,907,104 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 41,900,362 - 41,907,099 (+) Ensembl GRCm39 Ensembl GRCm38 19 41,911,871 - 41,918,665 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 41,911,923 - 41,918,660 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 41,986,361 - 41,993,155 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 41,965,271 - 41,971,976 (+) NCBI MGSCv36 mm8 Celera 19 42,711,451 - 42,718,243 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 35.44 NCBI
Pgam1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955507 3,562,513 - 3,571,400 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955507 3,562,513 - 3,571,400 (+) NCBI ChiLan1.0 ChiLan1.0
PGAM1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 109,340,381 - 109,347,709 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 109,345,921 - 109,353,028 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 94,048,829 - 94,056,082 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 97,542,558 - 97,549,867 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 97,542,558 - 97,549,867 (+) Ensembl panpan1.1 panPan2
PGAM1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 10,720,235 - 10,727,709 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 10,720,094 - 10,930,286 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 10,902,930 - 10,910,408 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 11,042,559 - 11,050,038 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 11,042,496 - 11,050,038 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 10,703,632 - 10,711,101 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 10,764,397 - 10,771,643 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 10,904,327 - 10,911,807 (+) NCBI UU_Cfam_GSD_1.0
Pgam1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 36,201,336 - 36,209,529 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936636 2,236,508 - 2,248,768 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936636 2,240,452 - 2,248,689 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PGAM1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 108,822,812 - 108,833,058 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 108,822,782 - 108,832,818 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 118,326,760 - 118,336,762 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PGAM1
Pgam1
.
Predicted Target Of
Count of predictions: 455 Count of miRNA genes: 235 Interacting mature miRNAs: 288 Transcripts: ENSRNOT00000071965 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071965 ⟹ ENSRNOP00000065690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 240,723,920 - 240,738,452 (+) Ensembl Rnor_6.0 Ensembl 1 261,158,261 - 261,165,808 (+) Ensembl
RefSeq Acc Id:
NM_053290 ⟹ NP_445742
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,673,152 - 250,680,762 (+) NCBI mRatBN7.2 1 240,723,832 - 240,731,443 (+) NCBI Rnor_6.0 1 261,158,204 - 261,165,814 (+) NCBI Rnor_5.0 1 268,610,733 - 268,618,280 (+) NCBI Celera 1 236,559,231 - 236,566,463 (+) NCBI
Sequence:
GTCTGTCTGGCGAGTGGAAAGATTTCGGGGAGAAAGTGCGCGGGAGCGGGGCGGGAGAGTGCAAGCGCGCAGGCGCGACCGGGGGGGGGGGGCGGGCTGCGAGGAGAATCTCAGCGATCCTCAGTTAC
hide sequence
RefSeq Acc Id:
NP_445742 ⟸ NM_053290
- UniProtKB:
Q6P0K6 (UniProtKB/Swiss-Prot), P25113 (UniProtKB/Swiss-Prot), A6JH90 (UniProtKB/TrEMBL)
- Sequence:
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEP
hide sequence
Ensembl Acc Id:
ENSRNOP00000065690 ⟸ ENSRNOT00000071965
RGD ID: 13690909 Promoter ID: EPDNEW_R1433 Type: initiation region Name: Pgam1_1 Description: phosphoglycerate mutase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 261,158,326 - 261,158,386 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-02
Pgam1
phosphoglycerate mutase 1
Pgam1
phosphoglycerate mutase 1 (brain)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-17
Pgam1
phosphoglycerate mutase 1 (brain)
Pgam1
phosphoglycerate mutase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pgam1
Phosphoglycerate mutase 1
Symbol and Name status set to approved
70586 APPROVED
