Symbol:
Padi2
Name:
peptidyl arginine deiminase 2
RGD ID:
3288
Description:
Enables protein-arginine deiminase activity. Predicted to be involved in several processes, including estrogen receptor signaling pathway; substantia nigra development; and transcription initiation-coupled chromatin remodeling. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in euchromatin. Predicted to be active in cytoplasm and nucleus. Orthologous to human PADI2 (peptidyl arginine deiminase 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Pdi2; peptidyl arginine deiminase type II; peptidyl arginine deiminase, type 2; peptidyl arginine deiminase, type II; peptidylarginine deiminase II; protein-arginine deiminase type II; protein-arginine deiminase type-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PADI2 (peptidyl arginine deiminase 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Padi2 (peptidyl arginine deiminase, type II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Padi2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PADI2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PADI2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Padi2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PADI2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PADI2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Padi2 (peptidyl arginine deiminase 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
STX11 (syntaxin 11) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Padi2 (peptidyl arginine deiminase, type II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PADI2 (peptidyl arginine deiminase 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
padi2 (peptidyl arginine deiminase, type II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
padi2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
creb1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 158,492,087 - 158,534,662 (+) NCBI GRCr8 mRatBN7.2 5 153,209,053 - 153,251,632 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 153,209,053 - 153,251,632 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 155,898,744 - 155,940,735 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 157,672,018 - 157,714,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 157,661,096 - 157,703,184 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 159,428,479 - 159,471,113 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 159,428,515 - 159,471,144 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 163,141,202 - 163,183,775 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 159,762,824 - 159,805,399 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 159,773,011 - 159,815,587 (+) NCBI Celera 5 151,567,606 - 151,616,600 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Padi2 Rat 1,2-dimethylhydrazine decreases expression ISO Padi2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PADI2 mRNA CTD PMID:22206623 Padi2 Rat 17alpha-ethynylestradiol increases expression ISO Padi2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of PADI2 mRNA CTD PMID:17942748 Padi2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PADI2 mRNA CTD PMID:12655037 and PMID:15834898 Padi2 Rat 17alpha-ethynylestradiol multiple interactions ISO Padi2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PADI2 mRNA CTD PMID:17942748 Padi2 Rat 17alpha-ethynylestradiol affects expression ISO Padi2 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of PADI2 mRNA CTD PMID:17555576 Padi2 Rat 17beta-estradiol increases expression ISO PADI2 (Homo sapiens) 6480464 Estradiol results in increased expression of PADI2 mRNA CTD PMID:21185374 and PMID:31614463 Padi2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PADI2 mRNA CTD PMID:32741896 Padi2 Rat 17beta-estradiol multiple interactions ISO PADI2 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PADI2 mRNA CTD PMID:30165855 Padi2 Rat 17beta-estradiol increases expression ISO Padi2 (Mus musculus) 6480464 Estradiol results in increased expression of PADI2 mRNA CTD PMID:15289156 more ... Padi2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PADI2 mRNA CTD PMID:32741896 Padi2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Padi2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Padi2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Padi2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PADI2 mRNA CTD PMID:17942748 Padi2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PADI2 mRNA CTD PMID:33387578 Padi2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PADI2 mRNA CTD PMID:22298810 and PMID:34747641 Padi2 Rat 2-acetamidofluorene multiple interactions ISO Padi2 (Mus musculus) 6480464 TRP53 protein modified form affects the reaction [2-Acetylaminofluorene results in increased expression of PADI2 mRNA] CTD PMID:17317680 Padi2 Rat 4,4'-sulfonyldiphenol increases methylation ISO Padi2 (Mus musculus) 6480464 bisphenol S results in increased methylation of PADI2 promoter CTD PMID:33297965 Padi2 Rat 4,4'-sulfonyldiphenol increases expression ISO Padi2 (Mus musculus) 6480464 bisphenol S results in increased expression of PADI2 mRNA CTD PMID:34850234 Padi2 Rat 4-phenylbutyric acid decreases expression ISO Padi2 (Mus musculus) 6480464 4-phenylbutyric acid results in decreased expression of PADI2 mRNA CTD PMID:28698385 Padi2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PADI2 mRNA CTD PMID:24780913 and PMID:25825206 Padi2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PADI2 mRNA CTD PMID:30047161 Padi2 Rat afimoxifene increases expression ISO Padi2 (Mus musculus) 6480464 afimoxifene results in increased expression of PADI2 mRNA CTD PMID:26879975 Padi2 Rat aflatoxin B1 increases methylation ISO PADI2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PADI2 gene CTD PMID:27153756 Padi2 Rat all-trans-retinoic acid increases expression ISO PADI2 (Homo sapiens) 6480464 Tretinoin results in increased expression of PADI2 mRNA CTD PMID:15894607 and PMID:33167477 Padi2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of PADI2 mRNA CTD PMID:35163327 Padi2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PADI2 mRNA CTD PMID:38685447 Padi2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PADI2 mRNA CTD PMID:30047161 Padi2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PADI2 mRNA CTD PMID:16483693 Padi2 Rat aristolochic acid A decreases expression ISO PADI2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PADI2 mRNA CTD PMID:33212167 Padi2 Rat arsenite(3-) multiple interactions ISO PADI2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PADI2 mRNA] CTD PMID:32406909 Padi2 Rat benzo[a]pyrene increases methylation ISO PADI2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PADI2 exon and Benzo(a)pyrene results in increased methylation of PADI2 promoter CTD PMID:27901495 Padi2 Rat benzo[a]pyrene decreases expression ISO PADI2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PADI2 mRNA CTD PMID:32234424 Padi2 Rat benzo[a]pyrene affects methylation ISO PADI2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PADI2 intron CTD PMID:30157460 Padi2 Rat bisphenol A increases expression ISO Padi2 (Mus musculus) 6480464 bisphenol A results in increased expression of PADI2 mRNA CTD PMID:26063408 and PMID:30951980 Padi2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PADI2 mRNA CTD PMID:25181051 Padi2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PADI2 mRNA CTD PMID:26496021 Padi2 Rat bisphenol AF decreases expression ISO Padi2 (Mus musculus) 6480464 bisphenol AF results in decreased expression of PADI2 mRNA CTD PMID:34850234 Padi2 Rat bisphenol F increases expression ISO Padi2 (Mus musculus) 6480464 bisphenol F results in increased expression of PADI2 mRNA CTD PMID:30951980 Padi2 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PADI2 protein CTD PMID:28903499 Padi2 Rat buta-1,3-diene decreases expression ISO Padi2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PADI2 mRNA CTD PMID:29038090 Padi2 Rat butanal increases expression ISO PADI2 (Homo sapiens) 6480464 butyraldehyde results in increased expression of PADI2 mRNA CTD PMID:26079696 Padi2 Rat carbon nanotube decreases expression ISO Padi2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Padi2 Rat chlorpyrifos decreases expression ISO Padi2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PADI2 mRNA CTD PMID:37019170 Padi2 Rat chromium(6+) multiple interactions ISO PADI2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of PADI2 mRNA CTD PMID:38479592 Padi2 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of PADI2 mRNA CTD PMID:30556269 Padi2 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of PADI2 mRNA CTD PMID:30556269 Padi2 Rat crocidolite asbestos increases methylation ISO PADI2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased methylation of PADI2 5' UTR CTD PMID:29523930 Padi2 Rat Dibutyl phosphate affects expression ISO PADI2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PADI2 mRNA CTD PMID:37042841 Padi2 Rat dibutyl phthalate increases expression ISO Padi2 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PADI2 mRNA CTD PMID:21266533 Padi2 Rat diethylstilbestrol increases expression ISO Padi2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of PADI2 mRNA CTD PMID:15289156 Padi2 Rat dioxygen increases expression ISO PADI2 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PADI2 mRNA CTD PMID:26516004 Padi2 Rat dorsomorphin multiple interactions ISO PADI2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Padi2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PADI2 mRNA CTD PMID:29391264 Padi2 Rat ethanol increases expression ISO Padi2 (Mus musculus) 6480464 Ethanol results in increased expression of PADI2 mRNA CTD PMID:30319688 Padi2 Rat finasteride affects expression EXP 6480464 Finasteride affects the expression of PADI2 mRNA CTD PMID:30768126 Padi2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PADI2 mRNA CTD PMID:21525395 Padi2 Rat fonofos increases methylation ISO PADI2 (Homo sapiens) 6480464 Fonofos results in increased methylation of PADI2 promoter CTD PMID:22847954 Padi2 Rat formaldehyde increases expression ISO PADI2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of PADI2 mRNA CTD PMID:28937961 Padi2 Rat furan increases expression EXP 6480464 furan results in increased expression of PADI2 mRNA CTD PMID:27387713 Padi2 Rat genistein increases expression ISO Padi2 (Mus musculus) 6480464 Genistein results in increased expression of PADI2 mRNA CTD PMID:15289156 Padi2 Rat genistein decreases expression ISO Padi2 (Mus musculus) 6480464 Genistein results in decreased expression of PADI2 mRNA CTD PMID:32186404 Padi2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of PADI2 mRNA CTD PMID:24395379 Padi2 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of PADI2 gene CTD PMID:31011160 Padi2 Rat GW 4064 increases expression ISO Padi2 (Mus musculus) 6480464 GW 4064 results in increased expression of PADI2 mRNA CTD PMID:26655953 Padi2 Rat hydrogen peroxide increases expression ISO PADI2 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PADI2 mRNA CTD PMID:32949572 Padi2 Rat lead(0) affects expression ISO PADI2 (Homo sapiens) 6480464 Lead affects the expression of PADI2 mRNA CTD PMID:28903495 Padi2 Rat Licochalcone B decreases expression ISO PADI2 (Homo sapiens) 6480464 licochalcone B results in decreased expression of PADI2 mRNA CTD PMID:33647349 Padi2 Rat lipopolysaccharide multiple interactions ISO PADI2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Padi2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PADI2 mRNA CTD PMID:38685447 Padi2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PADI2 mRNA CTD PMID:30047161 Padi2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PADI2 gene CTD PMID:35440735 Padi2 Rat mono(2-ethylhexyl) phthalate decreases expression ISO PADI2 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PADI2 mRNA CTD PMID:36695872 Padi2 Rat N-methyl-4-phenylpyridinium increases expression ISO PADI2 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PADI2 mRNA CTD PMID:24810058 Padi2 Rat nickel atom decreases expression ISO PADI2 (Homo sapiens) 6480464 Nickel results in decreased expression of PADI2 mRNA CTD PMID:25583101 Padi2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of PADI2 mRNA CTD PMID:33484710 Padi2 Rat O-methyleugenol decreases expression ISO PADI2 (Homo sapiens) 6480464 methyleugenol results in decreased expression of PADI2 mRNA CTD PMID:32234424 Padi2 Rat paclitaxel decreases expression ISO PADI2 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of PADI2 protein CTD PMID:15907983 Padi2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PADI2 mRNA CTD PMID:33387578 Padi2 Rat parathion increases methylation ISO PADI2 (Homo sapiens) 6480464 Parathion results in increased methylation of PADI2 promoter CTD PMID:22847954 Padi2 Rat pentanal increases expression ISO PADI2 (Homo sapiens) 6480464 pentanal results in increased expression of PADI2 mRNA CTD PMID:26079696 Padi2 Rat perfluorohexanesulfonic acid increases expression ISO Padi2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of PADI2 mRNA CTD PMID:37995155 Padi2 Rat pirinixic acid multiple interactions ISO PADI2 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of PADI2 mRNA CTD PMID:19710929 Padi2 Rat potassium chromate increases expression ISO PADI2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PADI2 mRNA CTD PMID:22714537 Padi2 Rat progesterone decreases expression ISO Padi2 (Mus musculus) 6480464 Progesterone results in decreased expression of PADI2 mRNA CTD PMID:22238285 Padi2 Rat propanal increases expression ISO PADI2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PADI2 mRNA CTD PMID:26079696 Padi2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PADI2 mRNA CTD PMID:28374803 Padi2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PADI2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Padi2 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PADI2 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PADI2 mRNA CTD PMID:35811015 Padi2 Rat SB 431542 multiple interactions ISO PADI2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Padi2 Rat silicon dioxide increases expression ISO PADI2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PADI2 mRNA CTD PMID:25895662 Padi2 Rat silicon dioxide increases expression ISO Padi2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PADI2 mRNA CTD PMID:29341224 Padi2 Rat sodium arsenite decreases expression ISO PADI2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PADI2 mRNA CTD PMID:34032870 Padi2 Rat sodium fluoride increases expression ISO Padi2 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of PADI2 protein CTD PMID:28918527 Padi2 Rat succimer multiple interactions ISO Padi2 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of PADI2 mRNA CTD PMID:21641980 Padi2 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PADI2 mRNA CTD PMID:30047161 Padi2 Rat tamoxifen affects expression ISO Padi2 (Mus musculus) 6480464 Tamoxifen affects the expression of PADI2 mRNA CTD PMID:17555576 Padi2 Rat terbufos increases methylation ISO PADI2 (Homo sapiens) 6480464 terbufos results in increased methylation of PADI2 promoter CTD PMID:22847954 Padi2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of PADI2 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of PADI2 mRNA CTD PMID:26496021 and PMID:32741896 Padi2 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PADI2 mRNA CTD PMID:16239168 Padi2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PADI2 mRNA CTD PMID:34492290 Padi2 Rat titanium dioxide decreases expression ISO Padi2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PADI2 mRNA CTD PMID:29128614 and PMID:29264374 Padi2 Rat titanium dioxide decreases methylation ISO Padi2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PADI2 promoter CTD PMID:35295148 Padi2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PADI2 mRNA CTD PMID:33387578 Padi2 Rat trichostatin A increases expression ISO PADI2 (Homo sapiens) 6480464 trichostatin A results in increased expression of PADI2 mRNA CTD PMID:24935251 and PMID:26272509 Padi2 Rat trichostatin A multiple interactions ISO PADI2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PADI2 mRNA CTD PMID:27188386 Padi2 Rat triphenyl phosphate affects expression ISO PADI2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PADI2 mRNA CTD PMID:37042841 Padi2 Rat tungsten decreases expression ISO Padi2 (Mus musculus) 6480464 Tungsten results in decreased expression of PADI2 mRNA CTD PMID:30912803 Padi2 Rat valproic acid increases methylation ISO PADI2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PADI2 gene CTD PMID:29154799 Padi2 Rat valproic acid multiple interactions ISO PADI2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PADI2 mRNA CTD PMID:27188386 Padi2 Rat valproic acid increases expression ISO PADI2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PADI2 mRNA CTD PMID:23179753 and PMID:26272509 Padi2 Rat valproic acid increases expression ISO Padi2 (Mus musculus) 6480464 Valproic Acid results in increased expression of PADI2 mRNA CTD PMID:21427059 Padi2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PADI2 mRNA CTD PMID:22570695
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (ISO) 6-propyl-2-thiouracil (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) Brodifacoum (EXP) buta-1,3-diene (ISO) butanal (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) finasteride (EXP) flutamide (EXP) fonofos (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) glycidol (EXP) glyphosate (EXP) GW 4064 (ISO) hydrogen peroxide (ISO) lead(0) (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) methimazole (EXP) methoxychlor (EXP) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) nitrofen (EXP) O-methyleugenol (ISO) paclitaxel (ISO) paracetamol (EXP) parathion (ISO) pentanal (ISO) perfluorohexanesulfonic acid (ISO) pirinixic acid (ISO) potassium chromate (ISO) progesterone (ISO) propanal (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium fluoride (ISO) succimer (ISO) sulfadimethoxine (EXP) tamoxifen (ISO) terbufos (ISO) testosterone (EXP) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP)
Padi2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 158,492,087 - 158,534,662 (+) NCBI GRCr8 mRatBN7.2 5 153,209,053 - 153,251,632 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 153,209,053 - 153,251,632 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 155,898,744 - 155,940,735 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 157,672,018 - 157,714,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 157,661,096 - 157,703,184 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 159,428,479 - 159,471,113 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 159,428,515 - 159,471,144 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 163,141,202 - 163,183,775 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 159,762,824 - 159,805,399 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 159,773,011 - 159,815,587 (+) NCBI Celera 5 151,567,606 - 151,616,600 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
PADI2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 17,066,761 - 17,119,451 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 17,066,761 - 17,119,451 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 17,393,256 - 17,445,946 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 17,265,843 - 17,318,535 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 17,140,558 - 17,191,236 NCBI Celera 1 15,715,602 - 15,768,303 (-) NCBI Celera Cytogenetic Map 1 p36.13 NCBI HuRef 1 15,637,268 - 15,689,337 (-) NCBI HuRef CHM1_1 1 17,501,602 - 17,554,329 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 16,877,198 - 16,929,905 (-) NCBI T2T-CHM13v2.0
Padi2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 140,633,685 - 140,679,897 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 140,633,655 - 140,679,897 (+) Ensembl GRCm39 Ensembl GRCm38 4 140,906,336 - 140,952,586 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 140,906,344 - 140,952,586 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 140,462,275 - 140,508,501 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 138,644,091 - 138,693,178 (+) NCBI MGSCv36 mm8 MGSCv36 4 140,178,503 - 140,224,662 (+) NCBI MGSCv36 mm8 Celera 4 142,714,994 - 142,753,117 (+) NCBI Celera Cytogenetic Map 4 D3 NCBI cM Map 4 73.01 NCBI
Padi2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955527 1,709,444 - 1,752,783 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955527 1,709,307 - 1,751,332 (+) NCBI ChiLan1.0 ChiLan1.0
PADI2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 210,009,732 - 210,062,423 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 209,128,609 - 209,181,304 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 16,011,708 - 16,064,344 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 17,067,729 - 17,120,513 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 17,067,729 - 17,120,513 (-) Ensembl panpan1.1 panPan2
PADI2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 81,116,031 - 81,147,889 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 81,116,140 - 81,145,043 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 77,641,018 - 77,685,332 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 81,749,888 - 81,794,334 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 81,749,859 - 81,794,317 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 78,502,939 - 78,547,380 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 79,519,889 - 79,564,357 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 80,588,375 - 80,632,825 (+) NCBI UU_Cfam_GSD_1.0
Padi2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 38,210,290 - 38,236,848 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 4,033,230 - 4,088,256 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 4,033,703 - 4,066,468 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PADI2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 75,696,481 - 75,755,890 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 75,696,476 - 75,755,977 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 70,039,608 - 70,099,180 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PADI2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 115,465,098 - 115,520,772 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 115,465,338 - 115,520,828 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 596,810 - 650,559 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Padi2
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
5
159448962
159448963
C
A
snv
WKY/N (MCW) , European Variation Archive Release 6, SHRSP/Gcrc (RGD), WKY/NCrl (RGD), WKY/Gcrc (RGD), WKY/NHsd (RGD), BXH3/CubMcwi (2020), HXB10/IpcvMcwi (2019), HXB20/IpcvMcwi (2020), HXB31/IpcvMcwi (2019), HXB4/IpcvMcwi (2020), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), WKY/NCrl (2019), WKY/N (2020), European Variation Archive Release 3, European Variation Archive Release 4, SHR/NHsd (RGD) View more Information
Predicted Target Of
Count of predictions: 132 Count of miRNA genes: 90 Interacting mature miRNAs: 107 Transcripts: ENSRNOT00000010183 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
RH128094
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 158,534,420 - 158,534,616 (+) Marker Load Pipeline mRatBN7.2 5 153,251,389 - 153,251,585 (+) MAPPER mRatBN7.2 Rnor_6.0 5 159,470,862 - 159,471,057 NCBI Rnor6.0 Rnor_5.0 5 163,183,533 - 163,183,728 UniSTS Rnor5.0 RGSC_v3.4 5 159,805,157 - 159,805,352 UniSTS RGSC3.4 Celera 5 151,616,358 - 151,616,553 UniSTS Cytogenetic Map 5 q36 UniSTS
RH132527
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 158,505,861 - 158,506,588 (+) Marker Load Pipeline mRatBN7.2 5 153,222,829 - 153,223,556 (+) MAPPER mRatBN7.2 Rnor_6.0 5 159,442,304 - 159,443,030 NCBI Rnor6.0 Rnor_5.0 5 163,154,977 - 163,155,703 UniSTS Rnor5.0 RGSC_v3.4 5 159,776,599 - 159,777,325 UniSTS RGSC3.4 Celera 5 151,581,380 - 151,582,106 UniSTS RH 3.4 Map 5 1051.3 UniSTS Cytogenetic Map 5 q36 UniSTS
BF386039
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 153,207,243 - 153,207,417 (+) MAPPER mRatBN7.2 Rnor_6.0 5 159,426,720 - 159,426,893 NCBI Rnor6.0 Rnor_5.0 5 163,139,393 - 163,139,566 UniSTS Rnor5.0 RGSC_v3.4 5 159,761,015 - 159,761,188 UniSTS RGSC3.4 Celera 5 151,565,797 - 151,565,970 UniSTS RH 3.4 Map 5 1052.9 UniSTS Cytogenetic Map 5 q36 UniSTS
BI297266
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 153,224,951 - 153,225,115 (+) MAPPER mRatBN7.2 Rnor_6.0 5 159,444,426 - 159,444,589 NCBI Rnor6.0 Rnor_5.0 5 163,157,099 - 163,157,262 UniSTS Rnor5.0 RGSC_v3.4 5 159,778,721 - 159,778,884 UniSTS RGSC3.4 Celera 5 151,583,502 - 151,583,665 UniSTS RH 3.4 Map 5 1053.1 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010183 ⟹ ENSRNOP00000010183
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 153,209,053 - 153,251,632 (+) Ensembl Rnor_6.0 Ensembl 5 159,428,515 - 159,471,144 (+) Ensembl
RefSeq Acc Id:
NM_017226 ⟹ NP_058922
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 158,492,087 - 158,534,662 (+) NCBI mRatBN7.2 5 153,209,053 - 153,251,632 (+) NCBI Rnor_6.0 5 159,428,529 - 159,471,104 (+) NCBI Rnor_5.0 5 163,141,202 - 163,183,775 (+) NCBI RGSC_v3.4 5 159,762,824 - 159,805,399 (+) RGD Celera 5 151,567,606 - 151,616,600 (+) RGD
Sequence:
CCTGTAGCAGGTGCTCATTCCCGGGAGCAGCGCGGACTGCAGCCGCCTCTGCGGGGAAAGATGCTGCGGGAGCGGACCGTACGGCTGCAATACGGGAGCCGCGTGGAGGCGGTGTACGTGCTGGGCAC
hide sequence
RefSeq Acc Id:
NP_058922 ⟸ NM_017226
- UniProtKB:
P20717 (UniProtKB/Swiss-Prot), A6ITP8 (UniProtKB/TrEMBL)
- Sequence:
MLRERTVRLQYGSRVEAVYVLGTQLWTDVYSAAPAGAKTFSLKHSEGVKVEVVRDGEAEEVVTNGKQRWALSPSTTLRLSMAQASTEASSDKVTVNYYEEDGSAPIDQAGLFLTAIEISLDVDADRDG
hide sequence
Ensembl Acc Id:
ENSRNOP00000010183 ⟸ ENSRNOT00000010183
RGD ID: 13694214 Promoter ID: EPDNEW_R4738 Type: single initiation site Name: Padi2_1 Description: peptidyl arginine deiminase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 159,428,508 - 159,428,568 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-14
Padi2
peptidyl arginine deiminase 2
Padi2
peptidyl arginine deiminase, type II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Padi2
peptidyl arginine deiminase, type II
Pdi2
peptidyl arginine deiminase, type 2
Symbol and Name updated
1299863 APPROVED
2002-06-10
Pdi2
peptidyl arginine deiminase, type 2
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_product
member of a family of peptidylarginine deiminases
69925
