Advanced Search (OLGA)

Gene: Pcp4 (Purkinje cell protein 4) Rattus norvegicus

Analyze

Symbol:

Pcp4

Name:

Purkinje cell protein 4

RGD ID:

3271

Description:

Enables RNA binding activity and calmodulin binding activity. Involved in several processes, including cellular response to L-glutamate; osteoblast differentiation; and positive regulation of dopamine secretion. Located in axon and neurofilament. Biomarker of status epilepticus. Orthologous to human PCP4 (Purkinje cell protein 4); INTERACTS WITH 1,2,4-trimethylbenzene; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

brain-specific antigen PCP-4; brain-specific polypeptide PEP-19; calmodulin regulator protein PCP4; LOC102551106; Neuron specific protein PEP-19 (Purkinje cell protein 4); neuron-specific protein PEP-19; pep-19; PEPZ19; uncharacterized LOC102551106

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PCP4 (Purkinje cell protein 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pcp4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pcp4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PCP4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PCP4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pcp4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PCP4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PCP4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pcp4 (Purkinje cell protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMEM120B (transmembrane protein 120B)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pcp4 (Purkinje cell protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PCP4 (Purkinje cell protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pcp4a (Purkinje cell protein 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	49,229,185 - 49,331,186 (+)	NCBI		GRCr8
mRatBN7.2	11	35,759,711 - 35,861,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	35,800,713 - 35,861,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	44,450,446 - 44,511,455 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	37,121,822 - 37,182,837 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	36,275,044 - 36,336,059 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	36,851,035 - 36,912,272 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	36,851,038 - 36,912,229 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	42,825,722 - 42,855,529 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	36,828,273 - 36,889,381 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	36,885,861 - 36,946,969 (+)	NCBI
Celera	11	35,698,717 - 35,758,778 (+)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Colonic Neoplasms (ISO)

Experimental Mammary Neoplasms (IEP)

Huntington's disease (ISO)

leiomyoma (ISO)

status epilepticus (IEP)

Water-Electrolyte Imbalance (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trimethylbenzene (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (EXP,ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

bromobenzene (EXP)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cocaine (EXP)

copper atom (EXP)

copper(0) (EXP)

coumestrol (ISO)

dexamethasone (EXP)

dibutyl phthalate (EXP)

diethyl phthalate (EXP)

diethylstilbestrol (EXP)

diisobutyl phthalate (EXP)

diisononyl phthalate (EXP)

diuron (EXP)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (EXP,ISO)

flurbiprofen (ISO)

fulvestrant (ISO)

genistein (ISO)

glycine betaine (EXP)

L-ascorbic acid (EXP)

methamphetamine (EXP)

N,N-diethyl-m-toluamide (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nitrofen (EXP)

paraquat (EXP)

perfluorooctanoic acid (EXP)

permethrin (EXP)

phenylephrine (EXP)

PhIP (EXP)

phorbol 13-acetate 12-myristate (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

sunitinib (ISO)

testosterone (EXP)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triclosan (ISO)

undecane (EXP)

valproic acid (EXP,ISO)

vinclozolin (EXP)

zinc atom (EXP,ISO)

zinc(0) (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to L-glutamate (IEP)

negative regulation of neuron apoptotic process (IDA,IMP)

negative regulation of protein kinase activity (IDA)

osteoblast differentiation (IEP)

positive regulation of CAMKK-AMPK signaling cascade (ISO,ISS)

positive regulation of dopamine secretion (IMP)

positive regulation of neuron differentiation (ISO,ISS)

positive regulation of neuron projection development (IMP)

Cellular Component

axon (IDA)

cytoplasm (IBA)

neurofilament (IDA)

protein-containing complex (ISO)

Molecular Function

calcium ion binding (IBA,ISO,ISS)

calmodulin binding (IBA,IDA,ISO)

protein binding (ISO)

RNA binding (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression of PEP-19 inhibits apoptosis in PC12 cells.	Erhardt JA, etal., Neuroreport. 2000 Nov 27;11(17):3719-23.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Gene expression in the rat supraoptic nucleus induced by chronic hyperosmolality versus hyposmolality.	Glasgow E, etal., Am J Physiol Regul Integr Comp Physiol. 2000 Oct;279(4):R1239-50.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Purkinje cell protein 4 positively regulates neurite outgrowth and neurotransmitter release.	Harashima S, etal., J Neurosci Res. 2011 Oct;89(10):1519-30. doi: 10.1002/jnr.22688. Epub 2011 Jun 10.
6.	Peptide 19-immunoreactive primary sensory neurons in the rat trigeminal ganglion.	Ichikawa H and Sugimoto T, Brain Res. 1999 Nov 6;846(2):274-9.
7.	Calmodulin-binding peptide PEP-19 modulates activation of calmodulin kinase II In situ.	Johanson RA, etal., J Neurosci. 2000 Apr 15;20(8):2860-6.
8.	PEP-19 overexpression in human uterine leiomyoma.	Kanamori T, etal., Mol Hum Reprod. 2003 Nov;9(11):709-17.
9.	Degradation of PEP-19, a calmodulin-binding protein, by calpain is implicated in neuronal cell death induced by intracellular Ca2+ overload.	Kanazawa Y, etal., Neuroscience. 2008 Jun 23;154(2):473-81. doi: 10.1016/j.neuroscience.2008.03.044. Epub 2008 Mar 26.
10.	Transcriptome analysis of the hippocampal CA1 pyramidal cell region after kainic acid-induced status epilepticus in juvenile rats.	Lauren HB, etal., PLoS One. 2010 May 20;5(5):e10733. doi: 10.1371/journal.pone.0010733.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	RNA-binding activity of the rat calmodulin-binding PEP-19 protein and of the long PEP-19 isoform.	Saladino P, etal., Int J Mol Med. 2012 Feb;29(2):141-5. doi: 10.3892/ijmm.2011.819. Epub 2011 Oct 20.
16.	Molecular cloning of a neuron-specific transcript and its regulation during normal and aberrant cerebellar development.	Sangameswaran L, etal., Proc Natl Acad Sci U S A 1989 Jul;86(14):5651-5.
17.	Gene expression profiling during rat mammary carcinogenesis induced by 7,12-dimethylbenzanthracene.	Souda M, etal., Int J Cancer. 2009 Sep 15;125(6):1285-97. doi: 10.1002/ijc.24396.
18.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	PEP-19 immunohistochemistry defines the basal ganglia and associated structures in the adult human brain, and is dramatically reduced in Huntington's disease.	Utal AK, etal., Neuroscience. 1998 Oct;86(4):1055-63.
21.	Expression of Pcp4 gene during osteogenic differentiation of bone marrow mesenchymal stem cells in vitro.	Xiao J, etal., Mol Cell Biochem. 2008 Feb;309(1-2):143-50. Epub 2007 Nov 16.

Additional References at PubMed

PMID:3464961	PMID:12060780	PMID:15489334	PMID:16780588	PMID:17273800	PMID:19106096	PMID:21491429	PMID:22197496	PMID:22458599	PMID:23204517	PMID:25048017	PMID:31686426

Genomics

Comparative Map Data

Pcp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	49,229,185 - 49,331,186 (+)	NCBI		GRCr8
mRatBN7.2	11	35,759,711 - 35,861,725 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	35,800,713 - 35,861,725 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	44,450,446 - 44,511,455 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	37,121,822 - 37,182,837 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	36,275,044 - 36,336,059 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	36,851,035 - 36,912,272 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	36,851,038 - 36,912,229 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	42,825,722 - 42,855,529 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	36,828,273 - 36,889,381 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	36,885,861 - 36,946,969 (+)	NCBI
Celera	11	35,698,717 - 35,758,778 (+)	NCBI		Celera
Cytogenetic Map	11	q11	NCBI

PCP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	39,867,438 - 39,929,392 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	39,867,438 - 39,929,397 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	21	41,239,364 - 41,301,317 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	40,161,217 - 40,223,192 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	21	40,161,216 - 40,223,190	NCBI
Celera	21	26,436,822 - 26,498,803 (+)	NCBI		Celera
Cytogenetic Map	21	q22.2	NCBI
HuRef	21	26,708,625 - 26,770,649 (+)	NCBI		HuRef
CHM1_1	21	40,800,092 - 40,862,070 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	21	38,251,577 - 38,313,599 (+)	NCBI		T2T-CHM13v2.0

Pcp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	96,268,806 - 96,326,993 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	96,268,806 - 96,326,993 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	96,467,606 - 96,525,793 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	96,467,606 - 96,525,793 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	96,689,213 - 96,747,396 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	96,572,516 - 96,630,703 (+)	NCBI		MGSCv36	mm8
Celera	16	97,545,310 - 97,603,962 (+)	NCBI		Celera
Cytogenetic Map	16	C4	NCBI
cM Map	16	56.97	NCBI

Pcp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	39,853,034 - 39,908,151 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955407	39,853,029 - 39,908,151 (+)	NCBI	ChiLan1.0	ChiLan1.0

PCP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	35,967,343 - 36,029,032 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	30,823,340 - 30,885,002 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	26,069,039 - 26,284,247 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	39,556,995 - 39,618,734 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	39,587,400 - 39,618,734 (+)	Ensembl	panpan1.1		panPan2

PCP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	34,529,688 - 34,584,497 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	34,529,683 - 34,584,501 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	33,806,794 - 33,861,644 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	34,042,065 - 34,096,949 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	34,042,060 - 34,096,953 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	33,911,758 - 33,966,609 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	33,917,714 - 33,972,563 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	34,410,101 - 34,464,804 (+)	NCBI		UU_Cfam_GSD_1.0

Pcp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	33,998,889 - 34,050,983 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	3,416,797 - 3,469,053 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	3,416,840 - 3,468,893 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	203,412,479 - 203,479,209 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	203,412,479 - 203,479,216 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

PCP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	83,791,520 - 83,855,289 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	83,791,458 - 83,855,336 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	11,658,279 - 11,722,107 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pcp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	29,630,747 - 29,682,995 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624745	29,630,990 - 29,682,965 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pcp4
767 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	99
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000002221, ENSRNOT00000061047
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat

Markers in Region

RH130970

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	35,861,456 - 35,861,641 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	36,912,004 - 36,912,188	NCBI	Rnor6.0
Rnor_5.0	11	40,437,848 - 40,438,032	UniSTS	Rnor5.0
RGSC_v3.4	11	36,889,159 - 36,889,343	UniSTS	RGSC3.4
Celera	11	35,758,510 - 35,758,694	UniSTS
RH 3.4 Map	11	263.2	UniSTS
Cytogenetic Map	11	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	42	113	80	79	48	25	48	6	194	84	93	45	58	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001270538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_013002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC142238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ493658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG665749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BG666168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB613293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ097405	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M24852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002221 ⟹ ENSRNOP00000002221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	35,800,713 - 35,861,725 (+)	Ensembl
Rnor_6.0 Ensembl	11	36,851,038 - 36,912,229 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000061047 ⟹ ENSRNOP00000057764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	35,800,713 - 35,861,725 (+)	Ensembl
Rnor_6.0 Ensembl	11	36,851,038 - 36,912,229 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105621 ⟹ ENSRNOP00000082469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	35,829,648 - 35,861,725 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119525 ⟹ ENSRNOP00000085635

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	35,859,602 - 35,861,725 (+)	Ensembl

RefSeq Acc Id:

NM_001270538 ⟹ NP_001257467

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	49,270,186 - 49,331,186 (+)	NCBI
mRatBN7.2	11	35,800,713 - 35,861,725 (+)	NCBI
Rnor_6.0	11	36,851,035 - 36,912,272 (+)	NCBI
Celera	11	35,698,717 - 35,758,778 (+)	NCBI

Sequence:

show sequence

AGCAGCCACCCCTGAGCATTGCCTTCTGAGCTGTTCTGTGGGACCAAGCTGCGGAGTCAGGCCA
ACATGAGTGAGAGACAAAGTGCTGGAGCGACCAATGGAAAAGACAAGACATCAGGAGATAATGG
CAAAGTGCTCACTGCCAGAGGAGGAATGGAGAAGTGCCTGGCACGATCCAGCCAGAACCTGCTC
GGTCTCTAAGAAAGCCAAGAGGATCTGCAGTGGAAATGCCTCGCTGGAGGCTCCTGAAATATAT
GGGCAGAAGAAGGTCCAAGAAGAATTTGATATCGACATGGATGCACCAGAGACAGAGCGTGCAG
CTGTGGCCATTCAGTCTCAGTTCAGAAAATTCCAGAAGAAAAAGGCAGGATCACAGTCCTAGTG
GGGAAGCTGCTTCCTGGTCCACCCGAAGACACCAAGTTCAACCACCGTCCATCCAGAAATGAGA
AGAACAATACCCTAGAGCAAAGTCATCCACACCCAGTACACACTCCGCTGCTAACCTGAAATGC
ATGAACAGAAACCCATAGTATTTATGCCCCTCTAGGCAGGTGTCCACAATAAAATTGTGAGCAG
CTTAATCTGTCTGTCTCCATTACAATTCCTCTGCAACGATTTTCCTCGATGTTGTAATAAAAAG
GAGGTAAGAGGAGCCAATCTAGTGTCTGCCTTCATTTCTCACATTAGGCGGGACCATA

hide sequence

RefSeq Acc Id:

NM_013002 ⟹ NP_037134

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	49,270,186 - 49,331,186 (+)	NCBI
mRatBN7.2	11	35,800,713 - 35,861,725 (+)	NCBI
Rnor_6.0	11	36,851,035 - 36,912,272 (+)	NCBI
Rnor_5.0	11	42,825,722 - 42,855,529 (+)	NCBI
RGSC_v3.4	11	36,828,273 - 36,889,381 (+)	RGD
Celera	11	35,698,717 - 35,758,778 (+)	NCBI

Sequence:

show sequence

AGCAGCCACCCCTGAGCATTGCCTTCTGAGCTGTTCTGTGGGACCAAGCTGCGGAGTCAGGCCA
ACATGAGTGAGAGACAAAGTGCTGGAGCGACCAATGGAAAAGACAAGACATCAGGAGATAATGA
TGGGCAGAAGAAGGTCCAAGAAGAATTTGATATCGACATGGATGCACCAGAGACAGAGCGTGCA
GCTGTGGCCATTCAGTCTCAGTTCAGAAAATTCCAGAAGAAAAAGGCAGGATCACAGTCCTAGT
GGGGAAGCTGCTTCCTGGTCCACCCGAAGACACCAAGTTCAACCACCGTCCATCCAGAAATGAG
AAGAACAATACCCTAGAGCAAAGTCATCCACACCCAGTACACACTCCGCTGCTAACCTGAAATG
CATGAACAGAAACCCATAGTATTTATGCCCCTCTAGGCAGGTGTCCACAATAAAATTGTGAGCA
GCTTAATCTGTCTGTCTCCATTACAATTCCTCTGCAACGATTTTCCTCGATGTTGTAATAAAAA
GGAGGTAAGAGGAGCCAATCTAGTGTCTGCCTTCATTTCTCACATTAGGCGGGACCATA

hide sequence

RefSeq Acc Id:

XM_039088042 ⟹ XP_038943970

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	49,229,185 - 49,331,145 (+)	NCBI
mRatBN7.2	11	35,759,711 - 35,861,684 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001257467	(Get FASTA)	NCBI Sequence Viewer
	NP_037134	(Get FASTA)	NCBI Sequence Viewer
	XP_038943970	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41828	(Get FASTA)	NCBI Sequence Viewer
	AAH59147	(Get FASTA)	NCBI Sequence Viewer
	CAD38515	(Get FASTA)	NCBI Sequence Viewer
	EDM10956	(Get FASTA)	NCBI Sequence Viewer
	EDM10957	(Get FASTA)	NCBI Sequence Viewer
	EDM10958	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002221.5
	ENSRNOP00000057764.2
	ENSRNOP00000082469.1
	ENSRNOP00000085635.1
	ENSRNOP00055023130
	ENSRNOP00060031000
	ENSRNOP00065017791
GenBank Protein	P63055	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037134 ⟸ NM_013002
- Peptide Label:	isoform PEP19
- UniProtKB:	P63055 (UniProtKB/Swiss-Prot), A0A8I5ZX37 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS hide sequence

RefSeq Acc Id:	NP_001257467 ⟸ NM_001270538
- Peptide Label:	isoform LPI
- UniProtKB:	Q8CHN7 (UniProtKB/TrEMBL), F7F9D7 (UniProtKB/TrEMBL), A0A8I6A0K8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEKTRHQEIMAKCSLPEEEWRSAWHDPARTCSVSKKAKRICSGNASLEAPEIYGQKKVQEEFDI DMDAPETERAAVAIQSQFRKFQKKKAGSQS hide sequence

Ensembl Acc Id:

ENSRNOP00000057764 ⟸ ENSRNOT00000061047

Ensembl Acc Id:

ENSRNOP00000002221 ⟸ ENSRNOT00000002221

RefSeq Acc Id:	XP_038943970 ⟸ XM_039088042
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZX37 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000082469 ⟸ ENSRNOT00000105621

Ensembl Acc Id:

ENSRNOP00000085635 ⟸ ENSRNOT00000119525

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P63055-F1-model_v2	AlphaFold	P63055	1-62	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3271	AgrOrtholog
BioCyc Gene	G2FUF-21702	BioCyc
Ensembl Genes	ENSRNOG00000001628	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055016900	UniProtKB/Swiss-Prot
	ENSRNOG00060021646	UniProtKB/Swiss-Prot
	ENSRNOG00065013889	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002221.7	UniProtKB/TrEMBL
	ENSRNOT00000061047.4	UniProtKB/Swiss-Prot
	ENSRNOT00000105621.1	UniProtKB/TrEMBL
	ENSRNOT00000119525.1	UniProtKB/TrEMBL
	ENSRNOT00055028716	UniProtKB/Swiss-Prot
	ENSRNOT00060037606	UniProtKB/Swiss-Prot
	ENSRNOT00065022899	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6888437	IMAGE-MGC_LOAD
InterPro	Calmodulin_Regulator_PCP4-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25510	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72910	IMAGE-MGC_LOAD
NCBI Gene	25510	ENTREZGENE
PANTHER	IG-LIKE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR15359:SF7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pcp4	PhenoGen
RatGTEx	ENSRNOG00000001628	RatGTEx
	ENSRNOG00055016900	RatGTEx
	ENSRNOG00060021646	RatGTEx
	ENSRNOG00065013889	RatGTEx
TIGR	TC216655
UniProt	A0A8I5ZX37	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A0K8	ENTREZGENE, UniProtKB/TrEMBL
	A6IQF3_RAT	UniProtKB/TrEMBL
	A6IQF4_RAT	UniProtKB/TrEMBL
	F7F9D7	ENTREZGENE, UniProtKB/TrEMBL
	P63055	ENTREZGENE, UniProtKB/Swiss-Prot
	Q8CHN7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	P07734	UniProtKB/Swiss-Prot
	Q63890	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Pcp4	Purkinje cell protein 4	LOC102551106	uncharacterized LOC102551106	Data merged from RGD:7703115	737654	PROVISIONAL
2013-12-18	LOC102551106	uncharacterized LOC102551106			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in cerebellum, thalamus caudate putamen, and olfactory bulb	633595

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD