Symbol:
Nefh
Name:
neurofilament heavy chain
RGD ID:
3159
Description:
Enables protein-macromolecule adaptor activity and toxic substance binding activity. A structural constituent of cytoskeleton. Involved in several processes, including cellular response to estradiol stimulus; nervous system development; and ovarian follicle atresia. Located in several cellular components, including dendrite; intermediate filament; and perikaryon. Used to study congenital hypothyroidism. Biomarker of glaucoma; hypothyroidism; phenylketonuria; sciatic neuropathy; and transient cerebral ischemia. Human ortholog(s) of this gene implicated in Charcot-Marie-Tooth disease axonal type 2CC; amyotrophic lateral sclerosis; amyotrophic lateral sclerosis type 1; and monoclonal gammopathy of uncertain significance. Orthologous to human NEFH (neurofilament heavy chain); PARTICIPATES IN amyotrophic lateral sclerosis pathway; INTERACTS WITH (-)-anisomycin; (R)-adrenaline; (R,R,R)-alpha-tocopherol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
200 kDa neurofilament protein; neurofilament heavy; neurofilament heavy polypeptide; neurofilament triplet H protein; neurofilament, heavy polypeptide; NF-H; Nfh
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NEFH (neurofilament heavy chain) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nefh (neurofilament, heavy polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nefh (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NEFH (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NEFH (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nefh (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NEFH (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NEFH (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nefh (neurofilament heavy chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NIBAN1 (niban apoptosis regulator 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Nefh (neurofilament, heavy polypeptide)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NEFH (neurofilament heavy chain)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ifc-2
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ifd-1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ifa-1
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
ifa-3
Alliance
DIOPT (Ensembl Compara|InParanoid)
Xenopus tropicalis (tropical clawed frog):
nefh
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 84,044,428 - 84,054,413 (-) NCBI GRCr8 mRatBN7.2 14 79,830,362 - 79,840,347 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 79,830,362 - 79,840,351 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 84,232,750 - 84,242,741 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 85,472,824 - 85,482,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 81,922,138 - 81,932,117 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 85,181,572 - 85,191,557 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 85,181,572 - 85,191,557 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 85,859,193 - 85,869,187 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 85,594,789 - 85,604,774 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 85,614,415 - 85,623,919 (-) NCBI Celera 14 78,720,827 - 78,730,812 (-) NCBI Celera Cytogenetic Map 14 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nefh Rat (-)-anisomycin decreases degradation EXP 6480464 Anisomycin results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat (R)-adrenaline affects expression EXP 6480464 Epinephrine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat (R,R,R)-alpha-tocopherol increases expression EXP 6480464 alpha-Tocopherol results in increased expression of NEFH protein modified form CTD PMID:18942769 Nefh Rat 1,2-dichlorobenzene affects expression EXP 6480464 2-dichlorobenzene affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat 1-chloro-2,4-dinitrobenzene affects binding ISO NEFH (Homo sapiens) 6480464 Dinitrochlorobenzene binds to NEFH protein CTD PMID:32991956 Nefh Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat 17beta-estradiol affects expression ISO NEFH (Homo sapiens) 6480464 Estradiol affects the expression of NEFH mRNA CTD PMID:14699072 Nefh Rat 17beta-estradiol multiple interactions ISO NEFH (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of NEFH mRNA CTD PMID:20404318 Nefh Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Nefh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nefh Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:33078273 Nefh Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Nefh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nefh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NEFH mRNA CTD PMID:32109520 Nefh Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of NEFH protein CTD PMID:19033394 Nefh Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO NEFH (Homo sapiens) 6480464 3 more ... CTD PMID:23146750 Nefh Rat 3,3',5,5'-tetrabromobisphenol A affects expression EXP 6480464 tetrabromobisphenol A affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NEFH protein CTD PMID:26068050 Nefh Rat 3-methyladenine multiple interactions ISO NEFH (Homo sapiens) 6480464 3-methyladenine inhibits the reaction [tri-o-cresyl phosphate results in decreased expression of NEFH protein] CTD PMID:23743148 Nefh Rat 5-aza-2'-deoxycytidine multiple interactions ISO NEFH (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of NEFH mRNA] CTD PMID:21095227 Nefh Rat 5-aza-2'-deoxycytidine affects expression ISO NEFH (Homo sapiens) 6480464 Decitabine affects the expression of NEFH mRNA CTD PMID:17145863 Nefh Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NEFH mRNA CTD PMID:24780913 and PMID:25825206 Nefh Rat 9-cis-retinoic acid increases expression ISO NEFH (Homo sapiens) 6480464 Alitretinoin results in increased expression of NEFH protein CTD PMID:23500671 Nefh Rat acetonitrile affects expression EXP 6480464 acetonitrile affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat actinomycin D decreases degradation EXP 6480464 Dactinomycin results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat aldicarb increases phosphorylation ISO NEFH (Homo sapiens) 6480464 Aldicarb results in increased phosphorylation of NEFH protein CTD PMID:16256972 Nefh Rat all-trans-retinoic acid increases expression ISO NEFH (Homo sapiens) 6480464 Tretinoin results in increased expression of NEFH mRNA CTD PMID:21934132 more ... Nefh Rat all-trans-retinoic acid affects expression ISO NEFH (Homo sapiens) 6480464 Tretinoin affects the expression of NEFH mRNA CTD PMID:31600526 Nefh Rat all-trans-retinoic acid increases expression ISO Nefh (Mus musculus) 6480464 Tretinoin results in increased expression of NEFH protein CTD PMID:28085149 Nefh Rat alpha-amanitin decreases degradation EXP 6480464 Alpha-Amanitin results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat amiodarone decreases expression EXP 6480464 Amiodarone results in decreased expression of NEFH mRNA CTD PMID:25659768 Nefh Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NEFH mRNA and Ammonium Chloride affects the expression of NEFH protein CTD PMID:16483693 Nefh Rat Ampullosporin multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of NEFH mRNA CTD PMID:16635253 Nefh Rat antirheumatic drug decreases expression ISO NEFH (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NEFH mRNA CTD PMID:24449571 Nefh Rat aristolochic acid A increases expression ISO NEFH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of NEFH mRNA CTD PMID:33212167 Nefh Rat arsane affects expression ISO NEFH (Homo sapiens) 6480464 Arsenic metabolite affects the expression of NEFH mRNA CTD PMID:17553662 Nefh Rat arsenic atom affects expression ISO NEFH (Homo sapiens) 6480464 Arsenic metabolite affects the expression of NEFH mRNA CTD PMID:17553662 Nefh Rat atrazine decreases expression ISO NEFH (Homo sapiens) 6480464 Atrazine results in decreased expression of NEFH mRNA CTD PMID:22378314 Nefh Rat atropine affects expression EXP 6480464 Atropine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat benzo[a]pyrene increases methylation ISO NEFH (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NEFH 5' UTR and Benzo(a)pyrene results in increased methylation of NEFH exon CTD PMID:27901495 Nefh Rat benzo[a]pyrene affects methylation ISO NEFH (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NEFH promoter CTD PMID:27901495 Nefh Rat benzyl benzoate affects expression EXP 6480464 benzyl benzoate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat bis(2-ethylhexyl) phthalate increases expression ISO Nefh (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NEFH mRNA CTD PMID:34319233 Nefh Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NEFH mRNA and bisphenol A results in decreased expression of NEFH protein CTD PMID:25181051 and PMID:27364615 Nefh Rat bisphenol A increases expression ISO Nefh (Mus musculus) 6480464 bisphenol A results in increased expression of NEFH mRNA and bisphenol A results in increased expression of NEFH protein CTD PMID:31574244 Nefh Rat bisphenol A multiple interactions EXP 6480464 fulvestrant inhibits the reaction [bisphenol A results in decreased expression of NEFH protein] CTD PMID:27364615 Nefh Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of NEFH protein CTD PMID:28903499 Nefh Rat butanal increases expression ISO NEFH (Homo sapiens) 6480464 butyraldehyde results in increased expression of NEFH mRNA CTD PMID:26079696 Nefh Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of NEFH mRNA CTD PMID:33453195 Nefh Rat caffeine affects expression EXP 6480464 Caffeine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat cannabidiol increases expression ISO NEFH (Homo sapiens) 6480464 Cannabidiol results in increased expression of NEFH mRNA CTD PMID:27918106 Nefh Rat carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat carbaryl increases phosphorylation ISO NEFH (Homo sapiens) 6480464 Carbaryl results in increased phosphorylation of NEFH protein CTD PMID:16256972 Nefh Rat carbon disulfide decreases expression EXP 6480464 Carbon Disulfide results in decreased expression of NEFH protein CTD PMID:16474999 more ... Nefh Rat carbon disulfide increases expression EXP 6480464 Carbon Disulfide results in increased expression of NEFH mRNA CTD PMID:17120161 and PMID:19165470 Nefh Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of NEFH mRNA CTD PMID:19395590 Nefh Rat CGP 52608 multiple interactions ISO NEFH (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NEFH gene] CTD PMID:28238834 Nefh Rat chlordecone increases expression ISO Nefh (Mus musculus) 6480464 Chlordecone results in increased expression of NEFH mRNA CTD PMID:33711761 Nefh Rat chlorpromazine affects expression EXP 6480464 Chlorpromazine affects the expression of NEFH mRNA CTD PMID:31324950 Nefh Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of NEFH mRNA CTD PMID:28385489 Nefh Rat cisplatin decreases expression ISO NEFH (Homo sapiens) 6480464 Cisplatin results in decreased expression of NEFH mRNA CTD PMID:27594783 Nefh Rat clofibrate decreases expression ISO Nefh (Mus musculus) 6480464 Clofibrate results in decreased expression of NEFH mRNA CTD PMID:25270620 Nefh Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of NEFH protein CTD PMID:19217266 Nefh Rat copper atom multiple interactions ISO NEFH (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of NEFH mRNA CTD PMID:24690739 Nefh Rat copper(0) multiple interactions ISO NEFH (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of NEFH mRNA CTD PMID:24690739 Nefh Rat copper(II) sulfate increases expression ISO NEFH (Homo sapiens) 6480464 Copper Sulfate results in increased expression of NEFH mRNA CTD PMID:19549813 Nefh Rat cordycepin decreases degradation EXP 6480464 cordycepin results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NEFH mRNA CTD PMID:26577399 Nefh Rat cycloheximide decreases expression EXP 6480464 Cycloheximide results in decreased expression of NEFH mRNA CTD PMID:19146868 Nefh Rat cycloheximide decreases degradation EXP 6480464 Cycloheximide results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat cyclosporin A decreases expression ISO Nefh (Mus musculus) 6480464 Cyclosporine results in decreased expression of NEFH mRNA CTD PMID:25270620 Nefh Rat cyclosporin A affects expression EXP 6480464 Cyclosporine affects the expression of NEFH mRNA CTD PMID:22954530 and PMID:31324950 Nefh Rat cyfluthrin increases expression ISO NEFH (Homo sapiens) 6480464 cyfluthrin results in increased expression of NEFH mRNA CTD PMID:32028016 Nefh Rat cypermethrin increases expression ISO NEFH (Homo sapiens) 6480464 cypermethrin results in increased expression of NEFH mRNA CTD PMID:32028016 Nefh Rat daidzein 7-O-beta-D-glucoside increases expression EXP 6480464 daidzin results in increased expression of NEFH mRNA and daidzin results in increased expression of NEFH protein CTD PMID:31034797 Nefh Rat deguelin decreases expression ISO NEFH (Homo sapiens) 6480464 deguelin results in decreased expression of NEFH mRNA CTD PMID:33512557 Nefh Rat diazepam affects expression EXP 6480464 Diazepam affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of NEFH mRNA CTD PMID:17452286 Nefh Rat diazinon decreases expression ISO Nefh (Mus musculus) 6480464 Diazinon results in decreased expression of NEFH protein CTD PMID:17239417 Nefh Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat dichlorvos affects expression EXP 6480464 Dichlorvos affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat dieldrin decreases expression EXP 6480464 Dieldrin results in decreased expression of NEFH mRNA CTD PMID:18812211 Nefh Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of NEFH mRNA CTD PMID:31199487 Nefh Rat dimethyl sulfoxide decreases expression ISO NEFH (Homo sapiens) 6480464 Dimethyl Sulfoxide results in decreased expression of NEFH mRNA CTD PMID:22105179 Nefh Rat diquat affects expression EXP 6480464 Diquat affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat disulfiram multiple interactions ISO NEFH (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of NEFH mRNA CTD PMID:24690739 Nefh Rat dorsomorphin multiple interactions ISO NEFH (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nefh Rat doxycycline increases expression EXP 6480464 Doxycycline results in increased expression of NEFH protein CTD PMID:33798505 Nefh Rat emetine decreases degradation EXP 6480464 Emetine results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat entinostat increases expression ISO NEFH (Homo sapiens) 6480464 entinostat results in increased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat ethanol affects expression EXP 6480464 Ethanol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat ethylene glycol affects expression EXP 6480464 Ethylene Glycol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of NEFH mRNA CTD PMID:30307764 Nefh Rat FR900359 affects phosphorylation ISO NEFH (Homo sapiens) 6480464 FR900359 affects the phosphorylation of NEFH protein CTD PMID:37730182 Nefh Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [bisphenol A results in decreased expression of NEFH protein] CTD PMID:27364615 Nefh Rat genistein increases methylation EXP 6480464 Genistein results in increased methylation of NEFH gene CTD PMID:28505145 Nefh Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NEFH mRNA CTD PMID:33387578 Nefh Rat glufosinate affects expression EXP 6480464 phosphinothricin affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat glycerol affects expression EXP 6480464 Glycerol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat graphite affects expression EXP 6480464 Graphite affects the expression of NEFH mRNA CTD PMID:29933104 Nefh Rat hydroquinone decreases expression ISO NEFH (Homo sapiens) 6480464 hydroquinone results in decreased expression of NEFH mRNA CTD PMID:31256213 Nefh Rat ketamine multiple interactions EXP 6480464 [ampullosporin co-treated with Ketamine] results in increased expression of NEFH mRNA CTD PMID:16635253 Nefh Rat lead diacetate increases expression ISO Nefh (Mus musculus) 6480464 lead acetate results in increased expression of NEFH protein CTD PMID:20797405 Nefh Rat lead(0) affects expression ISO NEFH (Homo sapiens) 6480464 Lead affects the expression of NEFH mRNA CTD PMID:28903495 Nefh Rat lead(II) chloride increases expression EXP 6480464 lead chloride results in increased expression of NEFH mRNA CTD PMID:19651682 Nefh Rat lithium sulfate affects expression EXP 6480464 lithium sulfate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat malathion affects expression EXP 6480464 Malathion affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat malathion increases expression EXP 6480464 Malathion results in increased expression of NEFH mRNA CTD PMID:28385489 Nefh Rat manganese(II) chloride decreases expression ISO Nefh (Mus musculus) 6480464 manganese chloride results in decreased expression of NEFH mRNA CTD PMID:15295902 Nefh Rat melatonin decreases phosphorylation ISO Nefh (Mus musculus) 6480464 Melatonin analog results in decreased phosphorylation of NEFH protein and Melatonin results in decreased phosphorylation of NEFH protein CTD PMID:18231852 Nefh Rat mercury dibromide decreases expression ISO NEFH (Homo sapiens) 6480464 mercuric bromide results in decreased expression of NEFH mRNA CTD PMID:26272509 Nefh Rat mercury dibromide multiple interactions ISO NEFH (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat methanol affects expression EXP 6480464 Methanol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of NEFH mRNA CTD PMID:19651682 Nefh Rat methylmercury chloride increases expression ISO NEFH (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NEFH mRNA CTD PMID:28001369 Nefh Rat methylmercury chloride decreases phosphorylation EXP 6480464 methylmercuric chloride results in decreased phosphorylation of NEFH protein CTD PMID:28821999 Nefh Rat Mipafox decreases expression ISO NEFH (Homo sapiens) 6480464 mipafox results in decreased expression of NEFH protein CTD PMID:27939611 Nefh Rat mitoxantrone affects response to substance ISO NEFH (Homo sapiens) 6480464 NEFH protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Nefh Rat morphine increases expression EXP 6480464 Morphine results in increased expression of NEFH mRNA CTD PMID:15183518 Nefh Rat N,N-dimethylformamide affects expression EXP 6480464 Dimethylformamide affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [tributyltin results in decreased expression of NEFH protein] CTD PMID:26079211 Nefh Rat ochratoxin A multiple interactions EXP 6480464 ochratoxin A results in decreased expression of and results in decreased phosphorylation of NEFH protein CTD PMID:24792326 Nefh Rat octanoic acid affects expression EXP 6480464 octanoic acid affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat octyl gallate affects expression EXP 6480464 octyl gallate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat ozone multiple interactions ISO Nefh (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NEFH mRNA CTD PMID:27106289 Nefh Rat paraoxon decreases expression ISO NEFH (Homo sapiens) 6480464 Paraoxon results in decreased expression of NEFH protein CTD PMID:27939611 Nefh Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of NEFH mRNA and Paraquat results in decreased expression of NEFH protein CTD PMID:19146868 more ... Nefh Rat parathion decreases expression EXP 6480464 Parathion results in decreased expression of NEFH mRNA CTD PMID:19146868 Nefh Rat parathion affects expression EXP 6480464 Parathion affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:21673325 Nefh Rat PCB138 multiple interactions ISO Nefh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Nefh Rat pentachlorophenol affects expression EXP 6480464 Pentachlorophenol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat phenylmercury acetate decreases expression ISO NEFH (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of NEFH mRNA CTD PMID:26272509 Nefh Rat phenylmercury acetate multiple interactions ISO NEFH (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat picoxystrobin decreases expression ISO NEFH (Homo sapiens) 6480464 picoxystrobin results in decreased expression of NEFH mRNA CTD PMID:33512557 Nefh Rat pirinixic acid multiple interactions ISO NEFH (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NEFH mRNA CTD PMID:19710929 Nefh Rat potassium citrate monohydrate affects expression EXP 6480464 Potassium Citrate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat potassium sulfate affects expression EXP 6480464 potassium sulfate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat progesterone decreases expression ISO NEFH (Homo sapiens) 6480464 Progesterone results in decreased expression of NEFH mRNA CTD PMID:18070364 Nefh Rat propan-2-ol affects expression EXP 6480464 2-Propanol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat propanal increases expression ISO NEFH (Homo sapiens) 6480464 propionaldehyde results in increased expression of NEFH mRNA CTD PMID:26079696 Nefh Rat propranolol affects expression EXP 6480464 Propranolol affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat puromycin decreases degradation EXP 6480464 Puromycin results in decreased degradation of NEFH mRNA CTD PMID:1280263 Nefh Rat resveratrol increases expression ISO NEFH (Homo sapiens) 6480464 resveratrol results in increased expression of NEFH protein CTD PMID:23651583 Nefh Rat Riluzole decreases phosphorylation EXP 6480464 Riluzole results in decreased phosphorylation of NEFH protein CTD PMID:19429076 Nefh Rat rotenone decreases expression ISO NEFH (Homo sapiens) 6480464 Rotenone results in decreased expression of NEFH mRNA CTD PMID:33512557 Nefh Rat sarin increases phosphorylation EXP 6480464 Sarin results in increased phosphorylation of NEFH protein CTD PMID:21439362 Nefh Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of NEFH mRNA CTD PMID:16733813 Nefh Rat SB 431542 multiple interactions ISO NEFH (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nefh Rat scopolamine multiple interactions ISO NEFH (Homo sapiens) 6480464 Ashwagandha inhibits the reaction [Scopolamine results in decreased expression of NEFH protein] and withanone inhibits the reaction [Scopolamine results in decreased expression of NEFH protein] CTD PMID:22096544 Nefh Rat scopolamine decreases expression ISO NEFH (Homo sapiens) 6480464 Scopolamine results in decreased expression of NEFH protein CTD PMID:22096544 Nefh Rat silicon dioxide decreases expression ISO NEFH (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of NEFH mRNA CTD PMID:25895662 Nefh Rat silicon dioxide increases expression ISO Nefh (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NEFH mRNA CTD PMID:29341224 Nefh Rat silicon dioxide increases expression ISO NEFH (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NEFH mRNA CTD PMID:23806026 Nefh Rat sodium arsenite multiple interactions ISO NEFH (Homo sapiens) 6480464 monoisoamyl-2 and 3-dimercaptosuccinate inhibits the reaction [sodium arsenite results in decreased expression of NEFH mRNA] CTD PMID:19615344 Nefh Rat sodium arsenite decreases phosphorylation EXP 6480464 sodium arsenite results in decreased phosphorylation of NEFH protein CTD PMID:18674524 Nefh Rat sodium arsenite decreases expression ISO NEFH (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NEFH mRNA CTD PMID:19615344 Nefh Rat sodium hydrogencarbonate affects expression EXP 6480464 Sodium Bicarbonate affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat Soman increases phosphorylation EXP 6480464 Soman results in increased phosphorylation of NEFH protein CTD PMID:21439362 Nefh Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of NEFH protein CTD PMID:30583000 Nefh Rat sunitinib decreases expression ISO NEFH (Homo sapiens) 6480464 Sunitinib results in decreased expression of NEFH mRNA CTD PMID:31533062 Nefh Rat T-2 toxin increases expression ISO NEFH (Homo sapiens) 6480464 T-2 Toxin results in increased expression of NEFH mRNA CTD PMID:34581912 Nefh Rat tamoxifen affects expression ISO NEFH (Homo sapiens) 6480464 Tamoxifen affects the expression of NEFH mRNA CTD PMID:14699072 Nefh Rat tetracycline affects expression EXP 6480464 Tetracycline affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat thapsigargin decreases expression ISO NEFH (Homo sapiens) 6480464 Thapsigargin results in decreased expression of NEFH mRNA CTD PMID:22378314 Nefh Rat thimerosal decreases expression ISO NEFH (Homo sapiens) 6480464 Thimerosal results in decreased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NEFH mRNA CTD PMID:23411599 Nefh Rat titanium dioxide decreases expression ISO Nefh (Mus musculus) 6480464 titanium dioxide results in decreased expression of NEFH mRNA CTD PMID:29264374 Nefh Rat titanium dioxide decreases methylation ISO Nefh (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NEFH gene CTD PMID:35295148 Nefh Rat tributylstannane multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [tributyltin results in decreased expression of NEFH protein] CTD PMID:26079211 Nefh Rat tributylstannane decreases expression EXP 6480464 tributyltin results in decreased expression of NEFH protein CTD PMID:26079211 Nefh Rat Tributyltin oxide decreases expression ISO Nefh (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of NEFH mRNA CTD PMID:25270620 Nefh Rat trichlorfon decreases expression ISO NEFH (Homo sapiens) 6480464 Trichlorfon results in decreased expression of NEFH protein CTD PMID:27939611 Nefh Rat trichostatin A increases expression ISO NEFH (Homo sapiens) 6480464 trichostatin A results in increased expression of NEFH mRNA CTD PMID:24935251 Nefh Rat trimethyltin multiple interactions EXP 6480464 [trimethyltin chloride results in increased abundance of trimethyltin] promotes the reaction [INS protein affects the expression of NEFH mRNA] CTD PMID:30993381 Nefh Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of NEFH mRNA CTD PMID:33078273 Nefh Rat triptonide increases expression ISO Nefh (Mus musculus) 6480464 triptonide results in increased expression of NEFH mRNA CTD PMID:33045310 Nefh Rat tris(2-chloroethyl) phosphate increases expression EXP 6480464 tris(chloroethyl)phosphate results in increased expression of NEFH protein CTD PMID:24717766 Nefh Rat tris(2-chloroethyl) phosphate decreases expression EXP 6480464 tris(chloroethyl)phosphate results in decreased expression of NEFH mRNA CTD PMID:24717766 Nefh Rat tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate affects expression EXP 6480464 Atropine affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat Tryptanthrine increases expression ISO NEFH (Homo sapiens) 6480464 tryptanthrine results in increased expression of NEFH protein CTD PMID:23500671 Nefh Rat tunicamycin decreases expression ISO NEFH (Homo sapiens) 6480464 Tunicamycin results in decreased expression of NEFH mRNA CTD PMID:22378314 Nefh Rat urea affects expression EXP 6480464 Urea affects the expression of NEFH mRNA CTD PMID:22954530 Nefh Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of NEFH mRNA and Valproic Acid results in decreased expression of NEFH protein CTD PMID:19651682 Nefh Rat valproic acid affects expression ISO NEFH (Homo sapiens) 6480464 Valproic Acid affects the expression of NEFH mRNA CTD PMID:25979313 Nefh Rat valproic acid decreases methylation ISO NEFH (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NEFH gene CTD PMID:29154799 Nefh Rat valproic acid multiple interactions ISO NEFH (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat valproic acid increases expression ISO NEFH (Homo sapiens) 6480464 Valproic Acid results in increased expression of NEFH mRNA CTD PMID:23179753 more ... Nefh Rat vorinostat increases expression ISO NEFH (Homo sapiens) 6480464 vorinostat results in increased expression of NEFH mRNA CTD PMID:27188386 Nefh Rat Withanone multiple interactions ISO NEFH (Homo sapiens) 6480464 withanone inhibits the reaction [Scopolamine results in decreased expression of NEFH protein] CTD PMID:22096544
Imported Annotations - KEGG (archival)
(-)-anisomycin (EXP) (R)-adrenaline (EXP) (R,R,R)-alpha-tocopherol (EXP) 1,2-dichlorobenzene (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,5-hexanedione (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-methylenedioxymethamphetamine (EXP) 3-methyladenine (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acetonitrile (EXP) actinomycin D (EXP) aldicarb (ISO) all-trans-retinoic acid (ISO) alpha-amanitin (EXP) amiodarone (EXP) ammonium chloride (EXP) Ampullosporin (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) atropine (EXP) benzo[a]pyrene (ISO) benzyl benzoate (EXP) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) cadmium dichloride (EXP) caffeine (EXP) cannabidiol (ISO) carbamazepine (EXP) carbaryl (ISO) carbon disulfide (EXP) carbonyl sulfide (EXP) CGP 52608 (ISO) chlordecone (ISO) chlorpromazine (EXP) chlorpyrifos (EXP) cisplatin (ISO) clofibrate (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cordycepin (EXP) Cuprizon (EXP) cycloheximide (EXP) cyclosporin A (EXP,ISO) cyfluthrin (ISO) cypermethrin (ISO) daidzein 7-O-beta-D-glucoside (EXP) deguelin (ISO) diazepam (EXP) diazinon (EXP,ISO) dibutyl phthalate (EXP) dichlorvos (EXP) dieldrin (EXP) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dimethyl sulfoxide (ISO) diquat (EXP) disulfiram (ISO) dorsomorphin (ISO) doxycycline (EXP) emetine (EXP) entinostat (ISO) ethanol (EXP) ethylene glycol (EXP) fenvalerate (EXP) FR900359 (ISO) fulvestrant (EXP) genistein (EXP) gentamycin (EXP) glufosinate (EXP) glycerol (EXP) graphite (EXP) hydroquinone (ISO) ketamine (EXP) lead diacetate (ISO) lead(0) (ISO) lead(II) chloride (EXP) lithium sulfate (EXP) malathion (EXP) manganese(II) chloride (ISO) melatonin (ISO) mercury dibromide (ISO) methanol (EXP) methylmercury chloride (EXP,ISO) Mipafox (ISO) mitoxantrone (ISO) morphine (EXP) N,N-dimethylformamide (EXP) N-acetyl-L-cysteine (EXP) ochratoxin A (EXP) octanoic acid (EXP) octyl gallate (EXP) orphenadrine (EXP) ozone (ISO) paraoxon (ISO) paraquat (EXP) parathion (EXP) PCB138 (EXP,ISO) pentachlorophenol (EXP) phenobarbital (EXP) phenylmercury acetate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) potassium citrate monohydrate (EXP) potassium sulfate (EXP) progesterone (ISO) propan-2-ol (EXP) propanal (ISO) propranolol (EXP) puromycin (EXP) resveratrol (ISO) Riluzole (EXP) rotenone (ISO) sarin (EXP) SB 431542 (ISO) scopolamine (ISO) silicon dioxide (ISO) sodium arsenite (EXP,ISO) sodium hydrogencarbonate (EXP) Soman (EXP) streptozocin (EXP) sunitinib (ISO) T-2 toxin (ISO) tamoxifen (ISO) tetracycline (EXP) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (EXP) Tributyltin oxide (ISO) trichlorfon (ISO) trichostatin A (ISO) trimethyltin (EXP) triphenyl phosphate (EXP) triptonide (ISO) tris(2-chloroethyl) phosphate (EXP) tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (EXP) Tryptanthrine (ISO) tunicamycin (ISO) urea (EXP) valproic acid (EXP,ISO) vorinostat (ISO) Withanone (ISO)
Biological Process
axon development (IBA,IEA,ISO) axon regeneration (IDA) cellular response to estradiol stimulus (IEP) cellular response to hydroperoxide (IEP) cellular response to leukemia inhibitory factor (IEA,ISO) cellular response to oxidative stress (IEP) cerebral cortex development (IEP) hippocampus development (IEP) intermediate filament bundle assembly (IBA,IEA,IGI,ISO) intermediate filament cytoskeleton organization (IEA,ISO) microtubule cytoskeleton organization (IEA,ISO) neurofilament bundle assembly (IEA,ISO) neurofilament cytoskeleton organization (IEA,ISO) neuron projection development (IEP) ovarian follicle atresia (IDA) peripheral nervous system neuron axonogenesis (IEA,ISO) postsynaptic intermediate filament cytoskeleton organization (IEA) postsynaptic modulation of chemical synaptic transmission (IEA,ISO) regulation of organelle transport along microtubule (IEA,ISO) response to acrylamide (IEP) response to cocaine (IEP) response to sodium arsenite (IDA) spinal cord development (IEP)
Cellular Component
apical dendrite (IDA) axon (IBA,IDA,IEA,ISO) basal proximal dendrite (IDA) cell projection (IEA) cytoplasm (IDA,IEA,ISO) cytoskeleton (IEA,ISO) intermediate filament (IDA,IEA) neurofibrillary tangle (IEA,ISO) neurofilament (IBA,IEA,ISO) neuronal cell body (IDA) perikaryon (IDA) postsynaptic density (IEA,ISO) postsynaptic intermediate filament cytoskeleton (IEA,ISO) Schaffer collateral - CA1 synapse (IEA,ISO)
1.
Deletions of the heavy neurofilament subunit tail in amyotrophic lateral sclerosis.
Al-Chalabi A, etal., Hum Mol Genet 1999 Feb;8(2):157-64.
2.
Heterodimeric associations between neuronal intermediate filament proteins.
Athlan ES and Mushynski WE, J Biol Chem. 1997 Dec 5;272(49):31073-8.
3.
Involvement of microglia in early axoglial alterations of the optic nerve induced by experimental glaucoma.
Bordone MP, etal., J Neurochem. 2017 Jul;142(2):323-337. doi: 10.1111/jnc.14070. Epub 2017 Jun 9.
4.
Partial sequence of the rat heavy neurofilament polypeptide (NF-H). Identification of putative phosphorylation sites [published erratum appears in FEBS Lett 1989 Feb 27;244(2):509]
Breen KC, etal., FEBS Lett 1988 Dec 5;241(1-2):213-8.
5.
Effects of brain ischemia on intermediate filaments of rat hippocampus.
Camargo-De-Morais M, etal., Neurochem Res. 1996 May;21(5):595-602.
6.
The C-terminal tail domain of neurofilament protein-H (NF-H) forms the crossbridges and regulates neurofilament bundle formation.
Chen J, etal., J Cell Sci. 2000 Nov;113 Pt 21:3861-9.
7.
Oxidative stress and 17-alpha- and 17-beta-estradiol modulate neurofilaments differently.
Chiasson K, etal., J Mol Neurosci. 2006;30(3):297-310.
8.
Transfected rat high-molecular-weight neurofilament (NF-H) coassembles with vimentin in a predominantly nonphosphorylated form.
Chin SS and Liem RK, J Neurosci 1990 Nov;10(11):3714-26.
9.
The large neurofilament subunit (NF-H) of the rat: cDNA cloning and in situ detection.
Dautigny A, etal., Biochem Biophys Res Commun 1988 Aug 15;154(3):1099-106.
10.
Regioselective binding of 2,5-hexanedione to high-molecular-weight rat neurofilament proteins in vitro.
DeCaprio AP, etal., Toxicol Appl Pharmacol. 1997 Jul;145(1):211-7.
11.
The prognostic value of neurofilament levels in patients with sepsis-associated encephalopathy - A prospective, pilot observational study.
Ehler J, etal., PLoS One. 2019 Jan 24;14(1):e0211184. doi: 10.1371/journal.pone.0211184. eCollection 2019.
12.
Requirement of heavy neurofilament subunit in the development of axons with large calibers.
Elder GA, etal., J Cell Biol 1998 Oct 5;143(1):195-205.
13.
NF-M is an essential target for the myelin-directed "outside-in" signaling cascade that mediates radial axonal growth.
Garcia ML, etal., J Cell Biol 2003 Dec 8;163(5):1011-20.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Perikaryal accumulation and proteolysis of neurofilament proteins in the post-mortem rat brain.
Geddes JW, etal., Neurobiol Aging. 1995 Jul-Aug;16(4):651-60.
16.
Regulation of neurofilament gene expression by thyroid hormone in the developing rat brain.
Ghosh S, etal., Neuroreport. 1999 Aug 2;10(11):2361-5.
17.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
18.
mRNA levels of all three neurofilament proteins decline following nerve transection.
Goldstein ME, etal., Brain Res. 1988 Jun;427(3):287-91.
19.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
20.
Spontaneous perikaryal neurofilament phosphorylation in the septofimbrial nucleus of the rat.
Klosen P and van den Bosch de Aguilar P, Neurosci Lett. 1992 May 11;139(1):108-13.
21.
Overexpression of neurofilament subunit NF-L and NF-H extends survival of a mouse model for amyotrophic lateral sclerosis.
Kong J and Xu Z, Neurosci Lett. 2000 Mar 3;281(1):72-4.
22.
The structure and organization of the human heavy neurofilament subunit (NF-H) and the gene encoding it.
Lees JF, etal., EMBO J 1988 Jul;7(7):1947-55.
23.
Cerebrospinal fluid light and heavy neurofilament level increased in anti-N-methyl-d-aspartate receptor encephalitis.
Li J, etal., Brain Behav. 2019 Aug;9(8):e01354. doi: 10.1002/brb3.1354. Epub 2019 Jul 17.
24.
Cloning of a cDNA encoding the rat high molecular weight neurofilament peptide (NF-H): developmental and tissue expression in the rat, and mapping of its human homologue to chromosomes 1 and 22.
Lieberburg I, etal., Proc Natl Acad Sci U S A 1989 Apr;86(7):2463-7.
25.
Vascular Endothelial Growth Factor-Transfected Bone Marrow Mesenchymal Stem Cells Improve the Recovery of Motor and Sensory Functions of Rats With Spinal Cord Injury.
Liu X, etal., Spine (Phila Pa 1976). 2020 Apr 1;45(7):E364-E372. doi: 10.1097/BRS.0000000000003333.
26.
Longitudinal Assessment of Transorbital Sonography, Visual Acuity, and Biomarkers for Inflammation and Axonal Injury in Optic Neuritis.
Lochner P, etal., Dis Markers. 2017;2017:5434310. doi: 10.1155/2017/5434310. Epub 2017 Sep 11.
27.
Differential expression and localization of the phosphorylated and nonphosphorylated neurofilaments during the early postnatal development of rat hippocampus.
Lopez-Picon FR, etal., Hippocampus. 2003;13(7):767-79.
28.
Impaired Neurofilament Integrity and Neuronal Morphology in Different Models of Focal Cerebral Ischemia and Human Stroke Tissue.
Mages B, etal., Front Cell Neurosci. 2018 Jun 18;12:161. doi: 10.3389/fncel.2018.00161. eCollection 2018.
29.
Allopregnanolone prevents and suppresses oxaliplatin-evoked painful neuropathy: multi-parametric assessment and direct evidence.
Meyer L, etal., Pain. 2011 Jan;152(1):170-81. doi: 10.1016/j.pain.2010.10.015. Epub 2010 Nov 10.
30.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
31.
Overexpression of MAP2 and NF-H Associated with Dendritic Pathology in the Spinal Cord of Mice Infected with Rabies Virus.
Monroy-Gómez J, etal., Viruses. 2018 Mar 6;10(3). pii: v10030112. doi: 10.3390/v10030112.
32.
Chronic cocaine administration causes extensive white matter damage in brain: diffusion tensor imaging and immunohistochemistry studies.
Narayana PA, etal., Psychiatry Res. 2014 Mar 30;221(3):220-30. doi: 10.1016/j.pscychresns.2014.01.005. Epub 2014 Jan 23.
33.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
34.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
35.
Neurofilament heavy chain expression and neuroplasticity in rat auditory cortex after unilateral and bilateral deafness.
Park MH, etal., Hear Res. 2016 Sep;339:155-60. doi: 10.1016/j.heares.2016.07.010. Epub 2016 Jul 22.
36.
Early in vitro genesis and differentiation of axons and dendrites by hippocampal neurons analyzed quantitatively with neurofilament-H and microtubule-associated protein 2 antibodies.
Pennypacker K, etal., Exp Neurol. 1991 Jan;111(1):25-35.
37.
The diagnostic and prognostic value of neurofilament heavy chain levels in immune-mediated optic neuropathies.
Petzold A and Plant GT, Mult Scler Int. 2012;2012:217802. doi: 10.1155/2012/217802. Epub 2012 Dec 17.
38.
Quantification of neurodegeneration by measurement of brain-specific proteins.
Petzold A, etal., J Neuroimmunol. 2003 May;138(1-2):45-8. doi: 10.1016/s0165-5728(03)00092-4.
39.
Axonal degeneration and inflammation in acute optic neuritis.
Petzold A, etal., J Neurol Neurosurg Psychiatry. 2004 Aug;75(8):1178-80. doi: 10.1136/jnnp.2003.017236.
40.
Treatment response in relation to inflammatory and axonal surrogate marker in multiple sclerosis.
Petzold A, etal., Mult Scler. 2004 Jun;10(3):281-3. doi: 10.1191/1352458504ms1021sr.
41.
The new global multiple sclerosis severity score (MSSS) correlates with axonal but not glial biomarkers.
Petzold A, etal., Mult Scler. 2006 Jun;12(3):325-8. doi: 10.1191/135248505ms1277oa.
42.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
43.
Neurofilament heavy chain and heat shock protein 70 as markers of seizure-related brain injury.
Rejdak K, etal., Epilepsia. 2012 May;53(5):922-7. doi: 10.1111/j.1528-1167.2012.03459.x. Epub 2012 Apr 17.
44.
Retarded development of neurons and oligodendroglia in rat forebrain produced by hyperphenylalaninemia results in permanent deficits in myelin despite long recovery periods.
Reynolds R, etal., Exp Neurol. 1993 Dec;124(2):357-67.
45.
GOA pipeline
RGD automated data pipeline
46.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
47.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
48.
Novel axonal distribution of neurofilament-H phosphorylated at the glycogen synthase kinase 3beta-phosphorylation site in its E-segment.
Sasaki T, etal., J Neurosci Res. 2009 Nov 1;87(14):3088-97. doi: 10.1002/jnr.22148.
49.
Neurotrophin-3 prevents the proximal accumulation of neurofilament proteins in sensory neurons of streptozocin-induced diabetic rats.
Sayers NM, etal., Diabetes. 2003 Sep;52(9):2372-80.
50.
Thyroid hormones stimulate expression and modification of cytoskeletal protein during rat sciatic nerve regeneration.
Schenker M, etal., Brain Res. 2002 Dec 13;957(2):259-70.
51.
Simultaneous up-regulation of neurofilament proteins during the postnatal development of the rat nervous system.
Schlaepfer WW and Bruce J, J Neurosci Res. 1990 Jan;25(1):39-49.
52.
[Tetramethylpyrazine accelerated spinal cord repair through regulation of caspase-3 and neurofilament protein expression: an acute spinal cord injury model in rats].
Shen ZX, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2008 Aug;33(8):693-9.
53.
Neurofilaments in blood and CSF for diagnosis and prediction of onset in Creutzfeldt-Jakob disease.
Steinacker P, etal., Sci Rep. 2016 Dec 8;6:38737. doi: 10.1038/srep38737.
54.
Anti-neurofilament antibodies in neuropathy with monoclonal gammopathy of undetermined significance produce experimental motor nerve conduction block.
Stubbs EB Jr, etal., Acta Neuropathol. 2003 Feb;105(2):109-16. Epub 2002 Sep 13.
55.
The involvement of neurofilament heavy chain phosphorylation in the maturation and degeneration of rat oocytes.
Takahashi N and Ishizuka B, Endocrinology. 2012 Apr;153(4):1990-8. doi: 10.1210/en.2011-2026. Epub 2012 Feb 7.
56.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
57.
Selective solubilization of high-molecular-mass neurofilament subunit during nerve regeneration.
Tsuda M, etal., J Neurochem. 2000 Feb;74(2):860-8.
58.
Arsenic-induced neurotoxicity in relation to toxicokinetics: effects on sciatic nerve proteins.
Vahidnia A, etal., Chem Biol Interact. 2008 Nov 25;176(2-3):188-95. doi: 10.1016/j.cbi.2008.07.001. Epub 2008 Jul 12.
59.
Artemin induced functional recovery and reinnervation after partial nerve injury.
Wang R, etal., Pain. 2014 Mar;155(3):476-84. doi: 10.1016/j.pain.2013.11.007. Epub 2013 Nov 21.
60.
DGKiota regulates presynaptic release during mGluR-dependent LTD.
Yang J, etal., EMBO J. 2011 Jan 5;30(1):165-80. doi: 10.1038/emboj.2010.286. Epub 2010 Nov 30.
61.
Acrylamide alters cytoskeletal protein level in rat sciatic nerves.
Yu S, etal., Neurochem Res. 2006 Oct;31(10):1197-204. Epub 2006 Oct 17.
62.
Congenital hypothyroidism is associated with intermediate filament misregulation, glutamate transporters down-regulation and MAPK activation in developing rat brain.
Zamoner A, etal., Neurotoxicology. 2008 Nov;29(6):1092-9. doi: 10.1016/j.neuro.2008.09.004. Epub 2008 Sep 18.
63.
Mechanisms Underlying H2O2-Evoked Carbonyl Modification of Cytoskeletal Protein and Axon Injury in PC-12 Cells.
Zhang X, etal., Cell Physiol Biochem. 2018;48(3):1088-1098. doi: 10.1159/000491975. Epub 2018 Jul 24.
Nefh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 84,044,428 - 84,054,413 (-) NCBI GRCr8 mRatBN7.2 14 79,830,362 - 79,840,347 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 79,830,362 - 79,840,351 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 84,232,750 - 84,242,741 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 85,472,824 - 85,482,815 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 81,922,138 - 81,932,117 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 85,181,572 - 85,191,557 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 85,181,572 - 85,191,557 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 85,859,193 - 85,869,187 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 85,594,789 - 85,604,774 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 85,614,415 - 85,623,919 (-) NCBI Celera 14 78,720,827 - 78,730,812 (-) NCBI Celera Cytogenetic Map 14 q21 NCBI
NEFH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 29,480,218 - 29,491,390 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 29,480,218 - 29,491,390 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 29,876,207 - 29,887,379 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 28,206,219 - 28,217,279 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 28,200,772 - 28,211,829 NCBI Celera 22 13,676,024 - 13,687,118 (+) NCBI Celera Cytogenetic Map 22 q12.2 NCBI HuRef 22 12,839,995 - 12,851,105 (+) NCBI HuRef CHM1_1 22 29,835,584 - 29,846,662 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 29,943,567 - 29,954,761 (+) NCBI T2T-CHM13v2.0
Nefh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 4,888,754 - 4,898,064 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 4,888,754 - 4,898,064 (-) Ensembl GRCm39 Ensembl GRCm38 11 4,938,754 - 4,948,064 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 4,938,754 - 4,948,064 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 4,838,757 - 4,848,067 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 4,838,761 - 4,851,268 (-) NCBI MGSCv36 mm8 Celera 11 5,436,254 - 5,444,974 (-) NCBI Celera Cytogenetic Map 11 A1 NCBI cM Map 11 3.12 NCBI
Nefh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 3,735,410 - 3,744,107 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 3,735,330 - 3,744,714 (+) NCBI ChiLan1.0 ChiLan1.0
NEFH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 39,453,989 - 39,465,030 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 42,155,232 - 42,166,273 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 10,525,738 - 10,536,788 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 28,331,778 - 28,341,874 (+) NCBI panpan1.1 PanPan1.1 panPan2
NEFH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 22,726,523 - 22,735,129 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 22,726,526 - 22,735,125 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 22,598,106 - 22,606,671 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 23,100,617 - 23,109,200 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 23,100,626 - 23,109,200 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 22,810,029 - 22,818,553 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 23,073,295 - 23,081,873 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 23,138,184 - 23,146,781 (+) NCBI UU_Cfam_GSD_1.0
Nefh Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 112,417,611 - 112,427,289 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936657 3,443,485 - 3,453,133 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936657 3,443,406 - 3,453,096 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NEFH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 46,559,860 - 46,568,088 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 46,559,698 - 46,568,686 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 49,572,997 - 49,583,859 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NEFH
Nefh
.
Predicted Target Of
Count of predictions: 72 Count of miRNA genes: 60 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000011604 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 1582236 Gluco22 Glucose level QTL 22 3.3 0.0164 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 70153 Bp59 Blood pressure QTL 59 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 14 68757796 83368335 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 1582197 Gluco27 Glucose level QTL 27 3.4 0.0006 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 73415323 92554092 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 1582255 Gluco29 Glucose level QTL 29 3.1 0.0025 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 14 73415323 92554092 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 1582209 Gluco20 Glucose level QTL 20 3.8 0.0005 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 92554092 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
RH127468
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 79,830,405 - 79,830,599 (+) MAPPER mRatBN7.2 Rnor_6.0 14 85,181,616 - 85,181,809 NCBI Rnor6.0 Rnor_5.0 14 85,859,237 - 85,859,430 UniSTS Rnor5.0 RGSC_v3.4 14 85,594,833 - 85,595,026 UniSTS RGSC3.4 Celera 14 78,720,871 - 78,721,064 UniSTS RH 3.4 Map 14 554.1 UniSTS Cytogenetic Map 14 q21 UniSTS
RH94567
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 84,044,436 - 84,044,613 (+) Marker Load Pipeline mRatBN7.2 14 79,830,370 - 79,830,547 (+) MAPPER mRatBN7.2 Rnor_6.0 14 85,181,581 - 85,181,757 NCBI Rnor6.0 Rnor_5.0 14 85,859,202 - 85,859,378 UniSTS Rnor5.0 RGSC_v3.4 14 85,594,798 - 85,594,974 UniSTS RGSC3.4 Celera 14 78,720,836 - 78,721,012 UniSTS Cytogenetic Map 14 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
47
113
71
70
39
25
39
6
190
89
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011604 ⟹ ENSRNOP00000011604
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 79,830,362 - 79,840,347 (-) Ensembl Rnor_6.0 Ensembl 14 85,181,572 - 85,191,557 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110325 ⟹ ENSRNOP00000096290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 79,830,375 - 79,840,351 (-) Ensembl
RefSeq Acc Id:
NM_012607 ⟹ NP_036739
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 84,044,428 - 84,054,413 (-) NCBI mRatBN7.2 14 79,830,362 - 79,840,347 (-) NCBI Rnor_6.0 14 85,181,572 - 85,191,557 (-) NCBI Rnor_5.0 14 85,859,193 - 85,869,187 (-) NCBI RGSC_v3.4 14 85,594,789 - 85,604,774 (-) RGD Celera 14 78,720,827 - 78,730,812 (-) RGD
Sequence:
CCCGTCCCGGCCCCGCACTCCCGCTCCGCCGGCGGCCGCACCTGCTCCGGCCATGATGAGCTTCGGCGGCGCCGATGCGCTGCTGGGCGCCCCGTTCGCGCCGCTGCACGGAGGAGGCAGCCTGCACT
hide sequence
RefSeq Acc Id:
NP_036739 ⟸ NM_012607
- UniProtKB:
F1LRZ7 (UniProtKB/TrEMBL)
- Sequence:
MMSFGGADALLGAPFAPLHGGGSLHYALSRKAGAGGTRSAAGSSSGFHSWARTSVSSVSASPSRFRGAGAASSTDSLDTLSNGPEGCVVAAVAARSEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGE
hide sequence
Ensembl Acc Id:
ENSRNOP00000011604 ⟸ ENSRNOT00000011604
Ensembl Acc Id:
ENSRNOP00000096290 ⟸ ENSRNOT00000110325
RGD ID: 13699451 Promoter ID: EPDNEW_R9975 Type: single initiation site Name: Nefh_1 Description: neurofilament heavy SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 85,191,571 - 85,191,631 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-04-12
Nefh
neurofilament heavy chain
Nefh
neurofilament heavy
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-01-17
Nefh
neurofilament heavy
Nefh
neurofilament, heavy polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Nefh
Neurofilament, heavy polypeptide
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains 51 Lys-Ser-Pro repeat triplets, which are possible sites of phosphorylation
728968
