Symbol:
Myo1e
Name:
myosin IE
RGD ID:
3144
Description:
Predicted to enable several functions, including ATP hydrolysis activity; actin filament binding activity; and calmodulin binding activity. Predicted to be involved in several processes, including actin filament organization; glomerular filtration; and glomerulus development. Predicted to act upstream of or within several processes, including platelet-derived growth factor receptor signaling pathway; post-embryonic hemopoiesis; and vasculogenesis. Located in cuticular plate. Part of protein-containing complex. Human ortholog(s) of this gene implicated in focal segmental glomerulosclerosis 6. Orthologous to human MYO1E (myosin IE); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4-amino-2,6-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
myosin heavy chain myr 3; myosin I e; myosin-Ie; Myr3; MYR5; unconventional myosin 1E; Unconventional myosin from rat 5; unconventional myosin-Ie
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYO1E (myosin IE) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Myo1e (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myo1e (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MYO1E (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYO1E (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Myo1e (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYO1E (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYO1E (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Myo1e (myosin IE) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MYO1F (myosin IF) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Myo1e (myosin IE)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MYO1E (myosin IE)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
myo1ea (myosin IEa)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hum-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO5
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
myo1e.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Candidate Gene For:
Vetf5
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 79,768,828 - 79,961,048 (+) NCBI GRCr8 mRatBN7.2 8 70,887,934 - 71,080,180 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 70,887,870 - 71,080,169 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 76,421,230 - 76,614,265 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 74,694,252 - 74,887,286 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 72,532,530 - 72,725,108 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 76,644,715 - 76,840,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 76,754,492 - 76,839,593 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 76,241,676 - 76,432,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 74,680,727 - 74,884,376 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 74,699,780 - 74,903,430 (+) NCBI Celera 8 70,648,832 - 70,842,630 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Myo1e Rat (-)-epigallocatechin 3-gallate multiple interactions ISO MYO1E (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MYO1E mRNA CTD PMID:22079256 Myo1e Rat (1->4)-beta-D-glucan multiple interactions ISO Myo1e (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MYO1E mRNA CTD PMID:36331819 Myo1e Rat 1,2-dimethylhydrazine increases expression ISO Myo1e (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MYO1E mRNA CTD PMID:22206623 Myo1e Rat 1-chloro-2,4-dinitrobenzene affects binding ISO MYO1E (Homo sapiens) 6480464 Dinitrochlorobenzene binds to MYO1E protein CTD PMID:32991956 Myo1e Rat 17beta-estradiol decreases expression ISO Myo1e (Mus musculus) 6480464 Estradiol results in decreased expression of MYO1E mRNA CTD PMID:39298647 Myo1e Rat 17beta-estradiol increases expression ISO MYO1E (Homo sapiens) 6480464 Estradiol results in increased expression of MYO1E mRNA CTD PMID:31614463 Myo1e Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO MYO1E (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of MYO1E mRNA CTD PMID:29581250 Myo1e Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO MYO1E (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Myo1e Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MYO1E (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Myo1e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO MYO1E (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYO1E mRNA CTD PMID:20106945 Myo1e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYO1E mRNA CTD PMID:21215274 Myo1e Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of MYO1E mRNA] CTD PMID:21215274 Myo1e Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Myo1e (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MYO1E promoter] CTD PMID:19654925 Myo1e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Myo1e (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MYO1E mRNA CTD PMID:19770486 Myo1e Rat 2,4,6-tribromophenol decreases expression ISO MYO1E (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Myo1e Rat 2,6-dimethoxyphenol multiple interactions ISO MYO1E (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Myo1e Rat 2-deoxy-D-glucose decreases expression ISO MYO1E (Homo sapiens) 6480464 Deoxyglucose results in decreased expression of MYO1E mRNA CTD PMID:33770205 Myo1e Rat 2-hydroxypropanoic acid decreases expression ISO MYO1E (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MYO1E mRNA CTD PMID:30851411 Myo1e Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO MYO1E (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of MYO1E protein CTD PMID:31675489 Myo1e Rat 3,4-methylenedioxymethamphetamine increases expression ISO Myo1e (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MYO1E mRNA CTD PMID:20188158 Myo1e Rat 4,4'-diaminodiphenylmethane increases expression ISO Myo1e (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of MYO1E mRNA CTD PMID:18648102 Myo1e Rat 4,4'-sulfonyldiphenol affects expression ISO Myo1e (Mus musculus) 6480464 bisphenol S affects the expression of MYO1E mRNA CTD PMID:39298647 Myo1e Rat 4,4'-sulfonyldiphenol affects methylation ISO Myo1e (Mus musculus) 6480464 bisphenol S affects the methylation of MYO1E gene CTD PMID:31683443 Myo1e Rat 4,4'-sulfonyldiphenol multiple interactions ISO MYO1E (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of MYO1E gene CTD PMID:31601247 Myo1e Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of MYO1E mRNA CTD PMID:21346803 Myo1e Rat 4-hydroxyphenyl retinamide increases expression ISO Myo1e (Mus musculus) 6480464 Fenretinide results in increased expression of MYO1E mRNA CTD PMID:28973697 Myo1e Rat 5-fluorouracil increases expression ISO MYO1E (Homo sapiens) 6480464 Fluorouracil results in increased expression of MYO1E protein CTD PMID:15331170 Myo1e Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of MYO1E mRNA CTD PMID:24780913 Myo1e Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MYO1E mRNA CTD PMID:36843608 Myo1e Rat aflatoxin B1 increases expression ISO Myo1e (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of MYO1E mRNA CTD PMID:19770486 Myo1e Rat aflatoxin B1 increases methylation ISO MYO1E (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MYO1E gene CTD PMID:27153756 Myo1e Rat Aflatoxin B2 alpha decreases methylation ISO MYO1E (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of MYO1E intron CTD PMID:30157460 Myo1e Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MYO1E mRNA CTD PMID:16483693 Myo1e Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of MYO1E mRNA CTD PMID:30779732 Myo1e Rat aristolochic acid A decreases expression ISO MYO1E (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of MYO1E mRNA CTD PMID:33212167 Myo1e Rat Aroclor 1254 decreases expression ISO Myo1e (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of MYO1E mRNA CTD PMID:25270620 Myo1e Rat arsane affects methylation ISO MYO1E (Homo sapiens) 6480464 Arsenic affects the methylation of MYO1E gene CTD PMID:25304211 Myo1e Rat arsenic atom affects methylation ISO MYO1E (Homo sapiens) 6480464 Arsenic affects the methylation of MYO1E gene CTD PMID:25304211 Myo1e Rat arsenite(3-) multiple interactions ISO MYO1E (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MYO1E mRNA] CTD PMID:32406909 Myo1e Rat benzo[a]pyrene decreases expression ISO Myo1e (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of MYO1E mRNA CTD PMID:19770486 and PMID:21569818 Myo1e Rat benzo[a]pyrene affects methylation ISO MYO1E (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MYO1E intron CTD PMID:30157460 Myo1e Rat benzo[a]pyrene decreases expression ISO MYO1E (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MYO1E mRNA and Benzo(a)pyrene results in decreased expression of MYO1E protein CTD PMID:20064835 more ... Myo1e Rat beta-hexachlorocyclohexane decreases expression ISO Myo1e (Mus musculus) 6480464 beta-hexachlorocyclohexane results in decreased expression of MYO1E mRNA CTD PMID:25270620 Myo1e Rat beta-lapachone increases expression ISO MYO1E (Homo sapiens) 6480464 beta-lapachone results in increased expression of MYO1E mRNA CTD PMID:38218311 Myo1e Rat bisphenol A increases expression ISO Myo1e (Mus musculus) 6480464 bisphenol A results in increased expression of MYO1E mRNA CTD PMID:21932408 and PMID:26063408 Myo1e Rat bisphenol A decreases expression ISO MYO1E (Homo sapiens) 6480464 bisphenol A results in decreased expression of MYO1E protein CTD PMID:31675489 Myo1e Rat bisphenol A multiple interactions ISO MYO1E (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MYO1E gene CTD PMID:31601247 Myo1e Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MYO1E mRNA CTD PMID:25181051 Myo1e Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MYO1E mRNA CTD PMID:26982218 Myo1e Rat bisphenol AF increases expression ISO MYO1E (Homo sapiens) 6480464 bisphenol AF results in increased expression of MYO1E protein CTD PMID:34186270 Myo1e Rat Bisphenol B increases expression ISO MYO1E (Homo sapiens) 6480464 bisphenol B results in increased expression of MYO1E protein CTD PMID:34186270 Myo1e Rat bleomycin A2 decreases expression ISO MYO1E (Homo sapiens) 6480464 Bleomycin results in decreased expression of MYO1E mRNA CTD PMID:33770205 Myo1e Rat cadmium atom multiple interactions ISO MYO1E (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MYO1E mRNA CTD PMID:35301059 Myo1e Rat cadmium dichloride multiple interactions ISO MYO1E (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MYO1E mRNA CTD PMID:35301059 Myo1e Rat caffeine decreases phosphorylation ISO MYO1E (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of MYO1E protein CTD PMID:35688186 Myo1e Rat camptothecin decreases expression ISO MYO1E (Homo sapiens) 6480464 Camptothecin results in decreased expression of MYO1E mRNA CTD PMID:33770205 Myo1e Rat chloroprene decreases expression ISO Myo1e (Mus musculus) 6480464 Chloroprene results in decreased expression of MYO1E mRNA CTD PMID:23125180 Myo1e Rat ciguatoxin CTX1B affects expression ISO Myo1e (Mus musculus) 6480464 Ciguatoxins affects the expression of MYO1E mRNA CTD PMID:18353800 Myo1e Rat cobalt dichloride decreases expression ISO MYO1E (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MYO1E mRNA CTD PMID:19320972 and PMID:19376846 Myo1e Rat copper(II) sulfate increases expression ISO MYO1E (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MYO1E mRNA CTD PMID:19549813 Myo1e Rat coumarin decreases phosphorylation ISO MYO1E (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of MYO1E protein CTD PMID:35688186 Myo1e Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of MYO1E mRNA CTD PMID:26577399 Myo1e Rat cyclosporin A decreases expression ISO Myo1e (Mus musculus) 6480464 Cyclosporine results in decreased expression of MYO1E mRNA CTD PMID:19770486 Myo1e Rat cyclosporin A increases expression ISO MYO1E (Homo sapiens) 6480464 Cyclosporine results in increased expression of MYO1E mRNA CTD PMID:25562108 Myo1e Rat decabromodiphenyl ether decreases expression ISO MYO1E (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of MYO1E protein CTD PMID:31675489 Myo1e Rat dibutyl phthalate increases expression ISO Myo1e (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MYO1E mRNA CTD PMID:21266533 Myo1e Rat dorsomorphin multiple interactions ISO MYO1E (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYO1E mRNA CTD PMID:27188386 Myo1e Rat doxorubicin increases expression ISO MYO1E (Homo sapiens) 6480464 Doxorubicin results in increased expression of MYO1E mRNA CTD PMID:30031762 Myo1e Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of MYO1E mRNA CTD PMID:17920746 Myo1e Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of MYO1E mRNA CTD PMID:24793618 Myo1e Rat fulvestrant multiple interactions ISO MYO1E (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MYO1E gene and [bisphenol S co-treated with Fulvestrant] results in increased methylation of MYO1E gene CTD PMID:31601247 Myo1e Rat furfural multiple interactions ISO MYO1E (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Myo1e Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of MYO1E mRNA CTD PMID:24395379 Myo1e Rat hydroxyurea decreases expression ISO MYO1E (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of MYO1E mRNA CTD PMID:33770205 Myo1e Rat inulin multiple interactions ISO Myo1e (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MYO1E mRNA CTD PMID:36331819 Myo1e Rat ivermectin decreases expression ISO MYO1E (Homo sapiens) 6480464 Ivermectin results in decreased expression of MYO1E protein CTD PMID:32959892 Myo1e Rat L-ascorbic acid decreases expression EXP 6480464 Ascorbic Acid results in decreased expression of MYO1E mRNA CTD PMID:15372504 Myo1e Rat lead(0) decreases expression ISO MYO1E (Homo sapiens) 6480464 Lead results in decreased expression of MYO1E mRNA CTD PMID:19921347 Myo1e Rat leflunomide increases expression ISO MYO1E (Homo sapiens) 6480464 leflunomide results in increased expression of MYO1E mRNA CTD PMID:28988120 Myo1e Rat lithium chloride increases expression ISO Myo1e (Mus musculus) 6480464 Lithium Chloride results in increased expression of MYO1E mRNA CTD PMID:26272751 Myo1e Rat methotrexate affects response to substance ISO MYO1E (Homo sapiens) 6480464 MYO1E protein affects the susceptibility to Methotrexate CTD PMID:16217747 Myo1e Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of MYO1E mRNA CTD PMID:25972201 Myo1e Rat nickel sulfate increases expression ISO MYO1E (Homo sapiens) 6480464 nickel sulfate results in increased expression of MYO1E mRNA CTD PMID:16780908 Myo1e Rat nitrates multiple interactions ISO Myo1e (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MYO1E mRNA CTD PMID:35964746 Myo1e Rat panobinostat increases expression ISO MYO1E (Homo sapiens) 6480464 Panobinostat results in increased expression of MYO1E mRNA CTD PMID:33770205 Myo1e Rat paracetamol increases expression ISO Myo1e (Mus musculus) 6480464 Acetaminophen results in increased expression of MYO1E mRNA CTD PMID:17585979 Myo1e Rat paracetamol increases expression ISO MYO1E (Homo sapiens) 6480464 Acetaminophen results in increased expression of MYO1E mRNA CTD PMID:22230336 and PMID:29067470 Myo1e Rat paracetamol affects expression ISO Myo1e (Mus musculus) 6480464 Acetaminophen affects the expression of MYO1E mRNA CTD PMID:17562736 Myo1e Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Myo1e (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MYO1E mRNA more ... CTD PMID:36331819 Myo1e Rat phenobarbital affects expression ISO MYO1E (Homo sapiens) 6480464 Phenobarbital affects the expression of MYO1E mRNA CTD PMID:19159669 Myo1e Rat phenobarbital decreases expression ISO Myo1e (Mus musculus) 6480464 Phenobarbital results in decreased expression of MYO1E mRNA CTD PMID:25270620 Myo1e Rat phenytoin increases expression ISO Myo1e (Mus musculus) 6480464 Phenytoin results in increased expression of MYO1E mRNA CTD PMID:26272751 Myo1e Rat pirinixic acid decreases expression ISO Myo1e (Mus musculus) 6480464 pirinixic acid results in decreased expression of MYO1E mRNA CTD PMID:23811191 Myo1e Rat potassium chromate multiple interactions ISO MYO1E (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MYO1E mRNA CTD PMID:22079256 Myo1e Rat potassium chromate decreases expression ISO MYO1E (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of MYO1E mRNA CTD PMID:22079256 Myo1e Rat propiconazole decreases expression ISO Myo1e (Mus musculus) 6480464 propiconazole results in decreased expression of MYO1E mRNA CTD PMID:21278054 Myo1e Rat rac-lactic acid decreases expression ISO MYO1E (Homo sapiens) 6480464 Lactic Acid results in decreased expression of MYO1E mRNA CTD PMID:30851411 Myo1e Rat saccharin increases expression ISO Myo1e (Mus musculus) 6480464 Saccharin results in increased expression of MYO1E mRNA CTD PMID:26272751 Myo1e Rat SB 431542 multiple interactions ISO MYO1E (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYO1E mRNA CTD PMID:27188386 Myo1e Rat sodium arsenite decreases expression ISO MYO1E (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MYO1E mRNA CTD PMID:38568856 Myo1e Rat sodium arsenite increases expression ISO Myo1e (Mus musculus) 6480464 sodium arsenite results in increased expression of MYO1E mRNA CTD PMID:36209798 Myo1e Rat sodium chloride multiple interactions ISO MYO1E (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of MYO1E protein more ... CTD PMID:38598786 Myo1e Rat Soman increases expression EXP 6480464 Soman results in increased expression of MYO1E mRNA CTD PMID:19281266 Myo1e Rat sunitinib increases expression ISO MYO1E (Homo sapiens) 6480464 Sunitinib results in increased expression of MYO1E mRNA CTD PMID:31533062 Myo1e Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MYO1E mRNA CTD PMID:16239168 Myo1e Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of MYO1E protein CTD PMID:35544339 Myo1e Rat thimerosal decreases expression ISO MYO1E (Homo sapiens) 6480464 Thimerosal results in decreased expression of MYO1E mRNA CTD PMID:27188386 Myo1e Rat thiram increases expression ISO MYO1E (Homo sapiens) 6480464 Thiram results in increased expression of MYO1E mRNA CTD PMID:38568856 Myo1e Rat titanium dioxide increases expression ISO Myo1e (Mus musculus) 6480464 titanium dioxide results in increased expression of MYO1E mRNA CTD PMID:23557971 Myo1e Rat trichostatin A increases expression ISO MYO1E (Homo sapiens) 6480464 trichostatin A results in increased expression of MYO1E mRNA CTD PMID:24935251 Myo1e Rat triphenyl phosphate affects expression ISO MYO1E (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MYO1E mRNA CTD PMID:37042841 Myo1e Rat tungsten decreases expression ISO Myo1e (Mus musculus) 6480464 Tungsten results in decreased expression of MYO1E mRNA CTD PMID:30912803 Myo1e Rat urethane increases expression ISO MYO1E (Homo sapiens) 6480464 Urethane results in increased expression of MYO1E mRNA CTD PMID:28818685 Myo1e Rat valproic acid increases methylation ISO MYO1E (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MYO1E gene CTD PMID:29154799 Myo1e Rat valproic acid increases expression ISO MYO1E (Homo sapiens) 6480464 Valproic Acid results in increased expression of MYO1E mRNA CTD PMID:23179753 and PMID:26272509 Myo1e Rat valproic acid multiple interactions ISO MYO1E (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MYO1E mRNA CTD PMID:27188386
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,6-dimethoxyphenol (ISO) 2-deoxy-D-glucose (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-hexachlorocyclohexane (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bleomycin A2 (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) camptothecin (ISO) chloroprene (ISO) ciguatoxin CTX1B (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethanol (EXP) flutamide (EXP) fulvestrant (ISO) furfural (ISO) glycidol (EXP) hydroxyurea (ISO) inulin (ISO) ivermectin (ISO) L-ascorbic acid (EXP) lead(0) (ISO) leflunomide (ISO) lithium chloride (ISO) methotrexate (ISO) mifepristone (EXP) nickel sulfate (ISO) nitrates (ISO) panobinostat (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenytoin (ISO) pirinixic acid (ISO) potassium chromate (ISO) propiconazole (ISO) rac-lactic acid (ISO) saccharin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sunitinib (ISO) tetrachloromethane (EXP) thapsigargin (EXP) thimerosal (ISO) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
1.
Myosin-I isozymes in neonatal rodent auditory and vestibular epithelia.
Dumont RA, etal., J Assoc Res Otolaryngol 2002 Dec;3(4):375-89. Epub 2002 Feb 27.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Myosin 1E interacts with synaptojanin-1 and dynamin and is involved in endocytosis.
Krendel M, etal., FEBS Lett. 2007 Feb 20;581(4):644-50. Epub 2007 Jan 18.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
A novel mammalian myosin I from rat with an SH3 domain localizes to Con A-inducible, F-actin-rich structures at cell-cell contacts.
Stoffler HE, etal., J Cell Biol 1995 May;129(3):819-30.
Myo1e Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 79,768,828 - 79,961,048 (+) NCBI GRCr8 mRatBN7.2 8 70,887,934 - 71,080,180 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 70,887,870 - 71,080,169 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 76,421,230 - 76,614,265 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 74,694,252 - 74,887,286 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 72,532,530 - 72,725,108 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 76,644,715 - 76,840,240 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 76,754,492 - 76,839,593 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 76,241,676 - 76,432,611 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 74,680,727 - 74,884,376 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 74,699,780 - 74,903,430 (+) NCBI Celera 8 70,648,832 - 70,842,630 (-) NCBI Celera Cytogenetic Map 8 q24 NCBI
MYO1E Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 59,132,434 - 59,372,871 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 59,132,434 - 59,372,871 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 59,424,633 - 59,665,070 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 57,215,855 - 57,452,363 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 57,215,855 - 57,452,363 NCBI Celera 15 36,316,513 - 36,553,029 (-) NCBI Celera Cytogenetic Map 15 q22.2 NCBI HuRef 15 36,250,377 - 36,487,296 (-) NCBI HuRef CHM1_1 15 59,546,143 - 59,783,017 (-) NCBI CHM1_1 T2T-CHM13v2.0 15 56,934,526 - 57,174,966 (-) NCBI T2T-CHM13v2.0
Myo1e Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 70,114,632 - 70,307,349 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 70,114,632 - 70,307,048 (+) Ensembl GRCm39 Ensembl GRCm38 9 70,207,350 - 70,400,067 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 70,207,350 - 70,399,766 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 70,055,157 - 70,247,874 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 70,006,514 - 70,199,231 (+) NCBI MGSCv36 mm8 Celera 9 67,429,438 - 67,616,081 (+) NCBI Celera Cytogenetic Map 9 D NCBI cM Map 9 39.41 NCBI
Myo1e Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 15,456,580 - 15,551,584 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 15,421,843 - 15,551,680 (+) NCBI ChiLan1.0 ChiLan1.0
MYO1E Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 48,401,647 - 48,638,895 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 52,584,087 - 52,820,740 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 38,106,599 - 38,343,040 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 56,413,570 - 56,649,683 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 56,413,570 - 56,649,722 (-) Ensembl panpan1.1 panPan2
MYO1E Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 30 24,067,622 - 24,265,567 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 30 24,068,283 - 24,265,311 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 30 24,041,333 - 24,239,771 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 30 24,236,065 - 24,434,141 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 30 24,236,074 - 24,433,904 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 30 24,161,240 - 24,360,201 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 30 24,244,241 - 24,442,581 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 30 24,387,998 - 24,586,599 (-) NCBI UU_Cfam_GSD_1.0
Myo1e Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 102,396,361 - 102,587,555 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 20,244,397 - 20,435,648 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 20,244,424 - 20,435,604 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MYO1E Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 112,677,821 - 112,901,993 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 112,677,545 - 112,902,005 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 124,676,396 - 124,901,516 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MYO1E Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 24,138,462 - 24,378,602 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 24,138,829 - 24,379,143 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 116,944,885 - 117,186,889 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Myo1e
.
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 49 Interacting mature miRNAs: 50 Transcripts: ENSRNOT00000016482 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
D8Rat195
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 71,035,636 - 71,035,802 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,792,194 - 76,792,361 NCBI Rnor6.0 Rnor_5.0 8 76,285,024 - 76,285,191 UniSTS Rnor5.0 RGSC_v3.4 8 74,831,544 - 74,831,712 RGD RGSC3.4 RGSC_v3.4 8 74,831,545 - 74,831,712 UniSTS RGSC3.4 RGSC_v3.1 8 74,850,457 - 74,850,839 RGD Celera 8 70,694,432 - 70,694,597 UniSTS FHH x ACI Map 8 51.31 RGD FHH x ACI Map 8 51.31 UniSTS Cytogenetic Map 8 q24 UniSTS
D8Got203
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 79,932,582 - 79,932,785 (+) Marker Load Pipeline mRatBN7.2 8 71,051,708 - 71,051,915 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,808,267 - 76,808,469 NCBI Rnor6.0 Rnor_5.0 8 76,268,916 - 76,269,118 UniSTS Rnor5.0 RGSC_v3.4 8 74,847,618 - 74,847,821 RGD RGSC3.4 RGSC_v3.4 8 74,847,619 - 74,847,821 UniSTS RGSC3.4 RGSC_v3.1 8 74,866,672 - 74,866,875 RGD Celera 8 70,678,340 - 70,678,554 UniSTS RH 2.0 Map 8 677.0 RGD Cytogenetic Map 8 q24 UniSTS
D8Got307
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 79,932,585 - 79,932,829 (+) Marker Load Pipeline mRatBN7.2 8 71,051,711 - 71,051,959 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,808,270 - 76,808,513 NCBI Rnor6.0 Rnor_5.0 8 76,268,872 - 76,269,115 UniSTS Rnor5.0 RGSC_v3.4 8 74,847,622 - 74,847,865 UniSTS RGSC3.4 Celera 8 70,678,296 - 70,678,551 UniSTS Cytogenetic Map 8 q24 UniSTS
RH132530
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 71,079,970 - 71,080,185 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,840,352 - 76,840,566 NCBI Rnor6.0 Rnor_5.0 8 76,241,350 - 76,241,564 UniSTS Rnor5.0 RGSC_v3.4 8 74,884,488 - 74,884,702 UniSTS RGSC3.4 Celera 8 70,648,506 - 70,648,720 UniSTS Cytogenetic Map 8 q24 UniSTS
AU049451
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 71,059,769 - 71,059,909 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,816,488 - 76,816,627 NCBI Rnor6.0 Rnor_5.0 8 76,260,971 - 76,261,110 UniSTS Rnor5.0 RGSC_v3.4 8 74,856,251 - 74,856,390 UniSTS RGSC3.4 Cytogenetic Map 8 q24 UniSTS
STS-Z41090
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 71,068,063 - 71,068,716 (+) MAPPER mRatBN7.2 Rnor_6.0 8 76,828,445 - 76,829,097 NCBI Rnor6.0 Rnor_5.0 8 76,252,819 - 76,253,471 UniSTS Rnor5.0 Celera 8 70,659,983 - 70,660,635 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000085727 ⟹ ENSRNOP00000074970
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 70,997,105 - 71,080,169 (+) Ensembl Rnor_6.0 Ensembl 8 76,754,492 - 76,839,593 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104863 ⟹ ENSRNOP00000083425
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 70,887,870 - 71,080,169 (+) Ensembl
RefSeq Acc Id:
NM_173101 ⟹ NP_775124
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,768,828 - 79,960,727 (+) NCBI mRatBN7.2 8 70,887,934 - 71,079,859 (+) NCBI Rnor_6.0 8 76,644,715 - 76,840,240 (+) NCBI Rnor_5.0 8 76,241,676 - 76,432,611 (-) NCBI RGSC_v3.4 8 74,680,727 - 74,884,376 (+) RGD Celera 8 70,648,832 - 70,842,630 (-) RGD
Sequence:
GACAGGCAGTCCTGCAGAGCGCATCAGGGTGCATCTCTAGACAGTTGGGGATCGCCAGGTCGGAGTGTGCACCGGGTCTGCTAAGTTTTGCCTTCACCCAGAGTCTTGGATCCCGCCTGGATGGAGTC
hide sequence
RefSeq Acc Id:
XM_039080888 ⟹ XP_038936816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 79,848,450 - 79,961,048 (+) NCBI mRatBN7.2 8 70,967,578 - 71,080,180 (+) NCBI
RefSeq Acc Id:
NP_775124 ⟸ NM_173101
- UniProtKB:
Q63356 (UniProtKB/Swiss-Prot), A0A0G2K9E8 (UniProtKB/TrEMBL)
- Sequence:
MGSKGAYRYHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVNPFKQMPYFGEKEIEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTVAAKYIMSY
hide sequence
Ensembl Acc Id:
ENSRNOP00000074970 ⟸ ENSRNOT00000085727
RefSeq Acc Id:
XP_038936816 ⟸ XM_039080888
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K9E8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000083425 ⟸ ENSRNOT00000104863
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Myo1e
myosin IE
Myr3
Unconventional myosin from rat 5
Symbol and Name updated
625702 APPROVED
2002-06-10
Myr3
Unconventional myosin from rat 5
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
highly expressed in hair cells of the auditory and vestibular epithelia
1298992
gene_expression
localized in cytoplasm and in elongated structures to F-actin-rich structures at regions of cell-cell contact
1298993
gene_function
function may be mediated by cell-cell contact
1298993
