Symbol:
Myh4 (Ensembl: Myh2)
Name:
myosin heavy chain 4 (Ensembl:myosin heavy chain 2)
RGD ID:
3139
Description:
Predicted to enable actin filament binding activity; double-stranded RNA binding activity; and microfilament motor activity. Involved in several processes, including response to gravity; response to muscle activity; and response to muscle stretch. Predicted to be located in myofibril. Predicted to be part of myosin II complex. Predicted to be active in cytoplasm and myosin filament. Biomarker of sciatic neuropathy. Orthologous to human MYH4 (myosin heavy chain 4); PARTICIPATES IN myocarditis pathway; INTERACTS WITH (+)-schisandrin B; 6-propyl-2-thiouracil; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2B myosin heavy chain; LOC360543; myHC-2b; myosin heavy chain 2b; myosin heavy chain type IIb; Myosin heavy polypeptide 4 skeletal muscle; myosin, heavy chain 4, skeletal muscle; myosin, heavy polypeptide 4; Myosin, heavy polypeptide 4, skeletal muscle; myosin-4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MYH4 (myosin heavy chain 4) HGNC
HomoloGene, NCBI, Panther
Mus musculus (house mouse):
Myh4 (myosin, heavy polypeptide 4, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Myh4 (myosin heavy chain 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC103786029 (myosin-4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MYH4 (myosin heavy chain 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101973267 (myosin-4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MYH4 (myosin, heavy chain 4, skeletal muscle) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MYH4 (myosin heavy chain 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
LOC101698292 (myosin-4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MYH4 (myosin heavy chain 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Myh4 (myosin, heavy polypeptide 4, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
myhz1.1 (myosin, heavy polypeptide 1.1, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myha (myosin, heavy chain a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myhz1.3 (myosin, heavy polypeptide 1.3, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myhz2 (myosin, heavy polypeptide 2, fast muscle specific)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myhb (myosin, heavy chain b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myhz1.2 (myosin, heavy polypeptide 1.2, skeletal muscle)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
myhc4 (myosin heavy chain 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MYO1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Mhc
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
myo-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
myo-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
myo-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
myo-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
myo-6
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
unc-54
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
myh3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 52,422,148 - 52,445,296 (+) NCBI GRCr8 mRatBN7.2 10 51,923,149 - 51,946,297 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 51,885,913 - 51,946,295 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 56,580,078 - 56,603,219 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 56,069,077 - 56,092,220 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 51,579,604 - 51,603,148 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 53,778,456 - 53,801,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 53,713,938 - 53,848,347 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 53,530,747 - 53,553,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 53,931,880 - 53,955,029 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 53,948,285 - 53,968,548 (+) NCBI Celera 10 51,105,822 - 51,128,615 (+) NCBI Celera RH 3.4 Map 10 571.9 RGD Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
1.
Parallel and divergent adaptations of rat soleus and plantaris to chronic exercise and hypergravity.
Fuller PM, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Feb;290(2):R442-8. Epub 2005 Sep 22.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.
Sequencing of the rat beta-catenin gene (Ctnnb1) and mutational analysis of liver tumors induced by 2-amino-3-methylimidazo[4,5-f]quinoline.
Li Q, etal., Gene 2002 Jan 23;283(1-2):255-62.
5.
Cloning and in situ hybridization of type 2A and 2B rat skeletal muscle myosin tail region: implications for filament assembly.
Lieber RL, etal., Biochem Biophys Res Commun 1993 Dec 30;197(3):1312-8.
6.
Heart failure-induced diaphragm myopathy.
Lima AR, etal., Cell Physiol Biochem. 2014;34(2):333-45. doi: 10.1159/000363003. Epub 2014 Jul 8.
7.
BDNF rescues myosin heavy chain IIB muscle fibers after neonatal nerve injury.
Mousavi K, etal., Am J Physiol Cell Physiol. 2004 Jul;287(1):C22-9. Epub 2004 Feb 18.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Differential modification of myosin heavy chain expression by tenotomy in regenerating fast and slow muscles of the rat.
Noirez P, etal., Exp Physiol. 2000 Mar;85(2):187-91.
10.
Sternohyoid and diaphragm muscle form and function during postnatal development in the rat.
O'Connell RA, etal., Exp Physiol. 2013 Sep;98(9):1386-400. doi: 10.1113/expphysiol.2013.073346. Epub 2013 May 24.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Myh4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 52,422,148 - 52,445,296 (+) NCBI GRCr8 mRatBN7.2 10 51,923,149 - 51,946,297 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 51,885,913 - 51,946,295 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 56,580,078 - 56,603,219 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 56,069,077 - 56,092,220 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 51,579,604 - 51,603,148 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 53,778,456 - 53,801,605 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 53,713,938 - 53,848,347 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 53,530,747 - 53,553,896 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 53,931,880 - 53,955,029 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 53,948,285 - 53,968,548 (+) NCBI Celera 10 51,105,822 - 51,128,615 (+) NCBI Celera RH 3.4 Map 10 571.9 RGD Cytogenetic Map 10 q24 NCBI
MYH4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 10,443,263 - 10,469,559 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 10,443,290 - 10,469,559 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 10,346,607 - 10,372,876 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 10,287,332 - 10,313,601 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 10,287,331 - 10,313,601 NCBI Celera 17 10,377,452 - 10,403,722 (-) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 10,246,185 - 10,272,452 (-) NCBI HuRef CHM1_1 17 10,356,450 - 10,382,720 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 10,350,703 - 10,377,048 (-) NCBI T2T-CHM13v2.0
Myh4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 67,128,638 - 67,151,273 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 67,128,855 - 67,151,272 (+) Ensembl GRCm39 Ensembl GRCm38 11 67,237,812 - 67,260,447 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 67,238,029 - 67,260,446 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 67,051,531 - 67,073,948 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 67,054,224 - 67,076,641 (+) NCBI MGSCv36 mm8 Celera 11 74,181,234 - 74,203,668 (+) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 40.59 NCBI
Myh4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955467 6,719,572 - 6,744,147 (+) NCBI ChiLan1.0 ChiLan1.0
LOC103786029 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 63,279,606 - 63,305,571 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 68,090,162 - 68,116,127 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 41,183,808 - 41,209,774 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 45,931,196 - 45,957,156 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 45,931,196 - 45,957,149 (+) Ensembl panpan1.1 panPan2
MYH4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 34,743,454 - 34,767,076 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 34,743,314 - 34,767,076 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 34,880,006 - 34,903,497 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 34,848,401 - 34,871,931 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 34,848,261 - 34,871,931 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 34,813,883 - 34,837,393 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 34,771,325 - 34,794,835 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 34,952,259 - 34,975,786 (-) NCBI UU_Cfam_GSD_1.0
LOC101973267
MYH4
MYH4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 9,786,143 - 9,811,908 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 9,786,240 - 9,809,098 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 11,533,281 - 11,556,520 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101698292
.
Predicted Target Of
Count of predictions: 66 Count of miRNA genes: 63 Interacting mature miRNAs: 64 Transcripts: ENSRNOT00000045718 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Myh1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 51,923,037 - 51,923,141 (+) MAPPER mRatBN7.2 Rnor_6.0 10 53,778,345 - 53,778,448 NCBI Rnor6.0 Rnor_5.0 10 53,530,636 - 53,530,739 UniSTS Rnor5.0 RGSC_v3.4 10 53,931,769 - 53,931,872 UniSTS RGSC3.4 Celera 10 51,105,711 - 51,105,814 UniSTS Cytogenetic Map 10 q24 UniSTS
UniSTS:265579
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 51,946,137 - 51,946,260 (+) MAPPER mRatBN7.2 Rnor_6.0 10 53,801,446 - 53,801,568 NCBI Rnor6.0 Rnor_5.0 10 53,553,737 - 53,553,859 UniSTS Rnor5.0 RGSC_v3.4 10 53,954,870 - 53,954,992 UniSTS RGSC3.4 Cytogenetic Map 10 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
27
99
58
57
26
25
26
6
137
75
79
20
47
31
Too many to show, limit is 500. Download them if you would like to view them all.
RefSeq Acc Id:
NM_019325 ⟹ NP_062198
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 52,422,148 - 52,445,296 (+) NCBI mRatBN7.2 10 51,923,149 - 51,946,297 (+) NCBI Rnor_6.0 10 53,778,456 - 53,801,605 (+) NCBI Rnor_5.0 10 53,530,747 - 53,553,896 (+) NCBI RGSC_v3.4 10 53,931,880 - 53,955,029 (+) RGD Celera 10 51,105,822 - 51,128,615 (+) RGD
Sequence:
CCGTAAAGTACTTGTCTGACTCAGCCTGCCTCCTTCTTCATCTGGTAACACAAGAGGTGCACCTGGCCCTAAGCTGCCCCCAATAGCTCGCAGCCATGAGTTCCGACGCCGAGATGGCCGTTTTTGGG
hide sequence
RefSeq Acc Id:
NP_062198 ⟸ NM_019325
- UniProtKB:
Q29RW1 (UniProtKB/Swiss-Prot), F1LMU0 (UniProtKB/TrEMBL)
- Sequence:
MSSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKSSVFVVDAKESYVKATVQSREGGKVTAKTEGGATVTVKEDQVFSMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNP
hide sequence
RGD ID: 13697293 Promoter ID: EPDNEW_R7816 Type: multiple initiation site Name: Myh4_2 Description: myosin heavy chain 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R7815 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 53,778,653 - 53,778,713 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-29
Myh4
myosin heavy chain 4
Myh4
myosin, heavy chain 4, skeletal muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-23
Myh4
myosin, heavy chain 4, skeletal muscle
Myh4
myosin, heavy polypeptide 4, skeletal muscle
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Myh4
myosin, heavy polypeptide 4, skeletal muscle
Myh4
myosin, heavy polypeptide 4
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-06-13
Myh4
myosin, heavy polypeptide 4
Myh4_predicted
myosin, heavy polypeptide 4, skeletal muscle (predicted)
Data merged from RGD:1311997
737654 APPROVED
2005-09-19
Myh4_predicted
myosin, heavy polypeptide 4, skeletal muscle (predicted)
Ctnnb1
catenin (cadherin-associated protein), beta 1 (88kD)
Data merged from RGD:620703
737654 APPROVED
2005-01-12
Myh4_predicted
myosin, heavy polypeptide 4, skeletal muscle (predicted)
Symbol and Name status set to approved
70820 APPROVED
2003-04-09
Myh4
myosin, heavy polypeptide 4
Myosin, heavy polypeptide 4, skeletal muscle
Name updated
629478 APPROVED
2002-08-07
Ctnnb1
catenin (cadherin-associated protein), beta 1 (88kD)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Myh4
Myosin, heavy polypeptide 4, skeletal muscle
Symbol and Name status set to approved
70586 APPROVED
