Advanced Search (OLGA)

Gene: Mpg (N-methylpurine-DNA glycosylase) Rattus norvegicus

Analyze

Symbol:

Mpg

Name:

N-methylpurine-DNA glycosylase

RGD ID:

3106

Description:

Predicted to enable DNA binding activity and alkylbase DNA N-glycosylase activity. Predicted to be involved in base-excision repair. Predicted to be located in mitochondrial nucleoid and nucleus. Orthologous to human MPG (N-methylpurine DNA glycosylase); PARTICIPATES IN base excision repair pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

3-alkyladenine DNA glycosylase; 3-methyladenine DNA glycosidase; ADPG; DNA-3-methyladenine glycosylase; N-methylpurine-DNA glycocylase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MPG (N-methylpurine DNA glycosylase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Mpg (N-methylpurine-DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mpg (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MPG (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MPG (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mpg (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MPG (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MPG (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mpg (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mpg (N-methylpurine DNA glycosylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mpg (N-methylpurine-DNA glycosylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MPG (N-methylpurine DNA glycosylase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mpg (N-methylpurine DNA glycosylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mpg	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mpg	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,900,697 - 15,906,981 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,899,635 - 15,907,052 (-)	Ensembl				GRCr8
mRatBN7.2	10	15,396,246 - 15,402,528 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	15,395,782 - 15,402,520 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	20,142,264 - 20,148,499 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,631,151 - 19,637,386 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	15,124,059 - 15,130,284 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	15,661,768 - 15,667,995 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,661,608 - 15,668,022 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	15,556,911 - 15,563,138 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	15,643,334 - 15,649,561 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	15,063,825 - 15,070,052 (-)	NCBI		Celera
RGSC_v3.1	10	15,644,406 - 15,650,564 (-)	NCBI
RH 3.4 Map	10	149.16	RGD
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

1H-imidazo[2,1-i]purine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-methyladenine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroperoxycyclophosphamide (EXP)

acrylamide (ISO)

ammonium chloride (EXP)

apigenin (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bezafibrate (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bromoacetate (ISO)

buta-1,3-diene (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carmustine (ISO)

chloroethene (EXP)

cisplatin (ISO)

copper(II) sulfate (ISO)

cycloheximide (ISO)

cyclophosphamide (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dimethyl sulfate (ISO)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

endosulfan (EXP)

ethyl methanesulfonate (ISO)

fenbuconazole (ISO)

fluoroethene (EXP)

folic acid (ISO)

FR900359 (ISO)

furan (EXP)

hydroxyurea (ISO)

imiquimod (ISO)

ivermectin (ISO)

methamphetamine (EXP)

Methoxyamine (ISO)

methyl methanesulfonate (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-methyl-N-nitrosourea (ISO)

O-methyleugenol (EXP)

ochratoxin A (EXP)

oxirane (EXP)

p-menthan-3-ol (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

resveratrol (EXP)

SCH 23390 (EXP)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

streptozocin (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

veliparib (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

base-excision repair (IBA,IEA,ISO)

DNA damage response (IEA)

DNA repair (IEA)

Cellular Component

cytoplasm (IEA)

cytosol (IEA,ISO)

mitochondrial nucleoid (IEA)

mitochondrion (ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

alkylbase DNA N-glycosylase activity (IBA,IEA,ISO)

catalytic activity (IEA)

DNA binding (IEA,ISO)

DNA N-glycosylase activity (IEA)

hydrolase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

base excision repair pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Isolation and structure of a cDNA expressing a mammalian 3-methyladenine-DNA glycosylase.	O'Connor TR and Laval F, EMBO J 1990 Oct;9(10):3337-42.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	Reactome: A Knowledgebase of Biological Processes	Reactome
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:8435858	PMID:8889548	PMID:9371767	PMID:15177041	PMID:34800366

Genomics

Comparative Map Data

Mpg
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,900,697 - 15,906,981 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,899,635 - 15,907,052 (-)	Ensembl				GRCr8
mRatBN7.2	10	15,396,246 - 15,402,528 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	15,395,782 - 15,402,520 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	20,142,264 - 20,148,499 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	19,631,151 - 19,637,386 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	15,124,059 - 15,130,284 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	15,661,768 - 15,667,995 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,661,608 - 15,668,022 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	15,556,911 - 15,563,138 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	15,643,334 - 15,649,561 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	15,063,825 - 15,070,052 (-)	NCBI		Celera
RGSC_v3.1	10	15,644,406 - 15,650,564 (-)	NCBI
RH 3.4 Map	10	149.16	RGD
Cytogenetic Map	10	q12	NCBI

MPG
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	77,007 - 85,846 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	77,007 - 85,851 (+)	Ensembl			hg38	GRCh38
GRCh37	16	127,006 - 135,845 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	67,018 - 75,845 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	69,146 - 75,841	NCBI
Celera	16	328,909 - 337,375 (+)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	45,422 - 54,310 (+)	NCBI		HuRef
CHM1_1	16	126,965 - 135,796 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	70,552 - 79,447 (+)	NCBI		T2T-CHM13v2.0

Mpg
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	32,176,505 - 32,182,702 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	32,176,505 - 32,182,700 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	32,226,505 - 32,232,702 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	32,226,505 - 32,232,700 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	32,126,505 - 32,132,702 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	32,126,511 - 32,132,700 (+)	NCBI		MGSCv36	mm8
Celera	11	34,643,783 - 34,649,980 (+)	NCBI		Celera
Cytogenetic Map	11	A4	NCBI
cM Map	11	18.83	NCBI

Mpg
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	17,068,395 - 17,075,588 (-)	Ensembl
ChiLan1.0	NW_004955442	17,068,327 - 17,077,569 (-)	NCBI	ChiLan1.0	ChiLan1.0

MPG
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	292,973 - 300,681 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	4,085,039 - 4,093,058 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	70,655 - 76,769 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	70,655 - 76,763 (+)	Ensembl			panPan2	panpan1.1

MPG
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	40,390,053 - 40,396,893 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	40,390,124 - 40,393,810 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	41,653,072 - 41,659,827 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	40,733,084 - 40,739,839 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	40,733,152 - 40,737,836 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	40,420,649 - 40,427,404 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	40,381,576 - 40,388,332 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	40,860,752 - 40,867,507 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mpg
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	112,685,548 - 112,693,280 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	783,475 - 791,146 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	783,408 - 791,109 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MPG
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	41,540,656 - 41,548,290 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	41,540,650 - 41,548,339 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	40,889,908 - 40,897,593 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MPG
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	35,073 - 42,290 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	35,114 - 43,581 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666068	31,182,322 - 31,189,552 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mpg
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	959,134 - 967,436 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624913	959,538 - 967,503 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mpg
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	3,651,212 - 3,657,463 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mpg
30 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	91
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000027940
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	15762230	19737486	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	1	17749933	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Markers in Region

D10Wox34

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	10	15,668,315 - 15,668,518	NCBI	Rnor6.0
Rnor_5.0	10	15,563,458 - 15,563,661	UniSTS	Rnor5.0
RGSC_v3.4	10	15,649,881 - 15,650,084	UniSTS	RGSC3.4
Cytogenetic Map	10	q12	UniSTS

RH94754

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	15,396,292 - 15,396,395 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	15,661,815 - 15,661,917	NCBI	Rnor6.0
Rnor_5.0	10	15,556,958 - 15,557,060	UniSTS	Rnor5.0
RGSC_v3.4	10	15,643,381 - 15,643,483	UniSTS	RGSC3.4
Celera	10	15,063,872 - 15,063,974	UniSTS
Cytogenetic Map	10	q12	UniSTS

RH142202

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	15,402,670 - 15,402,839 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	15,668,193 - 15,668,361	NCBI	Rnor6.0
Rnor_5.0	10	15,563,336 - 15,563,504	UniSTS	Rnor5.0
RGSC_v3.4	10	15,649,759 - 15,649,927	UniSTS	RGSC3.4
RH 3.4 Map	10	149.16	UniSTS
Cytogenetic Map	10	q12	UniSTS

BE097349

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	15,397,069 - 15,397,222 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	15,662,592 - 15,662,744	NCBI	Rnor6.0
Rnor_5.0	10	15,557,735 - 15,557,887	UniSTS	Rnor5.0
RGSC_v3.4	10	15,644,158 - 15,644,310	UniSTS	RGSC3.4
Celera	10	15,064,649 - 15,064,801	UniSTS
RH 3.4 Map	10	148.69	UniSTS
Cytogenetic Map	10	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	356	192	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001429907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_012601	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA899760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC096051	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW435341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB765983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X56420	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X94614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027940 ⟹ ENSRNOP00000027940

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	15,899,635 - 15,906,965 (-)	Ensembl
mRatBN7.2 Ensembl	10	15,395,782 - 15,402,520 (-)	Ensembl
Rnor_6.0 Ensembl	10	15,661,608 - 15,668,022 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085746 ⟹ ENSRNOP00000073752

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	15,900,698 - 15,907,052 (-)	Ensembl
mRatBN7.2 Ensembl	10	15,396,258 - 15,402,511 (-)	Ensembl
Rnor_6.0 Ensembl	10	15,661,792 - 15,667,955 (-)	Ensembl

RefSeq Acc Id:

NM_012601 ⟹ NP_036733

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,900,697 - 15,906,924 (-)	NCBI
mRatBN7.2	10	15,396,246 - 15,402,473 (-)	NCBI
Rnor_6.0	10	15,661,768 - 15,667,995 (-)	NCBI
Rnor_5.0	10	15,556,911 - 15,563,138 (-)	NCBI
RGSC_v3.4	10	15,643,334 - 15,649,561 (-)	RGD
Celera	10	15,063,825 - 15,070,052 (-)	RGD

Sequence:

show sequence

ATGCGCGGCCGCGGTGGTACTGCGCGCCTGGGCAGAGGATCCCTAAAACCGGTGTCCGTGGTGC
TCCCCGACACCGAGCACCCTGCATTTCCTGGACGAACCCGCCGCCCAGGGAATGCCAGAGCAGG
ATCCCAAGTGACCGGATCTCGTGAGGTCGGCCAGATGCCAGCGCCGCTTTCACGAAAGATCGGG
CAAAAAAAGCAGCAACTGGCACAGTCAGAGCAGCAGCAGACCCCTAAGGAGAGACTCTCTTCGA
CCCCTGGCCTCCTGCGAAGTATCTACTTCTCGAGCCCAGAGGACCGCCCTGCCCGGCTAGGACC
GGAGTATTTTGACCAGCCCGCAGTCACCCTAGCCCGTGCATTTCTGGGACAGGTCCTTGTCCGG
CGACTTGCTGATGGAACAGAACTCCGTGGGCGCATTGTAGAGACTGAGGCATACTTGGGGCCAG
AAGACGAAGCTGCCCACTCAAGGGGTGGCCGGCAGACCCCCCGTAACCGTGGCATGTTCATGAA
ACCTGGAACTCTGTACGTGTACCTCATCTATGGCATGTACTTCTGCTTGAATGTCTCCAGTCAA
GGGGCTGGGGCTTGTGTCTTGCTAAGAGCACTAGAGCCATTGGAGGGCCTAGAGACCATGCGGC
AGCTTCGAAACTCCCTCCGGAAAAGCACTGTCGGCCGTTCCCTCAAGGACCGCGAGCTCTGTAA
TGGTCCCTCCAAACTGTGCCAGGCCCTAGCCATTGATAAGAGCTTTGACCAGCGAGACCTGGCC
CAAGATGAGGCTGTGTGGCTGGAGCATGGCCCTCTGGAGTCCAGCAGCCCAGCTGTGGTGGCGG
CAGCCCGCATAGGTATTGGCCATGCAGGGGAATGGACACAGAAGCCCTTGCGCTTCTATGTCCA
GGGCAGCCCATGGGTCAGTGTGGTAGATAGAGTGGCTGAACAGATGTATCAGCCTCAGCAAACA
GCGTGCTCTGATTGTTCAAAAGTAAAATAAATAACTTGTTTGTAGAGAACTGTCCAAGTCTCAG
CCAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085191 ⟹ XP_038941119

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,902,324 - 15,906,981 (-)	NCBI
mRatBN7.2	10	15,396,982 - 15,402,528 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001416836	(Get FASTA)	NCBI Sequence Viewer
	NP_036733	(Get FASTA)	NCBI Sequence Viewer
	XP_038941119	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA39814	(Get FASTA)	NCBI Sequence Viewer
	CAA64321	(Get FASTA)	NCBI Sequence Viewer
	EDM04016	(Get FASTA)	NCBI Sequence Viewer
	EDM04017	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073752
GenBank Protein	P23571	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036733 ⟸ NM_012601

- UniProtKB:

D3ZEM0 (UniProtKB/TrEMBL), A6HDB1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRGRGGTARLGRGSLKPVSVVLPDTEHPAFPGRTRRPGNARAGSQVTGSREVGQMPAPLSRKIG
QKKQQLAQSEQQQTPKERLSSTPGLLRSIYFSSPEDRPARLGPEYFDQPAVTLARAFLGQVLVR
RLADGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRGMFMKPGTLYVYLIYGMYFCLNVSSQ
GAGACVLLRALEPLEGLETMRQLRNSLRKSTVGRSLKDRELCNGPSKLCQALAIDKSFDQRDLA
QDEAVWLEHGPLESSSPAVVAAARIGIGHAGEWTQKPLRFYVQGSPWVSVVDRVAEQMYQPQQT
ACSDCSKVK

hide sequence

Ensembl Acc Id:

ENSRNOP00000073752 ⟸ ENSRNOT00000085746

Ensembl Acc Id:

ENSRNOP00000027940 ⟸ ENSRNOT00000027940

RefSeq Acc Id:	XP_038941119 ⟸ XM_039085191
- Peptide Label:	isoform X1

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697078

Promoter ID:

EPDNEW_R7603

Type:

multiple initiation site

Name:

Mpg_1

Description:

N-methylpurine-DNA glycosylase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	15,668,031 - 15,668,091	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3106	AgrOrtholog
BioCyc Gene	G2FUF-25698	BioCyc
Ensembl Genes	ENSRNOG00000020571	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000085746	ENTREZGENE
Gene3D-CATH	3.10.300.10	UniProtKB/Swiss-Prot
InterPro	Formyl_transferase-like_C_sf	UniProtKB/Swiss-Prot
	MPG	UniProtKB/Swiss-Prot
	MPG_sf	UniProtKB/Swiss-Prot
NCBI Gene	24561	ENTREZGENE
PANTHER	DNA-3-METHYLADENINE GLYCOSYLASE	UniProtKB/Swiss-Prot
	PTHR10429	UniProtKB/Swiss-Prot
Pfam	Pur_DNA_glyco	UniProtKB/Swiss-Prot
PharmGKB	MPG	RGD
PhenoGen	Mpg	PhenoGen
RatGTEx	ENSRNOG00000020571	RatGTEx
Superfamily-SCOP	SSF50486	UniProtKB/Swiss-Prot
TIGR	TC219231
UniProt	3MG_RAT	UniProtKB/Swiss-Prot
	A0A0G2K6B9_RAT	UniProtKB/TrEMBL
	A6HDB1	ENTREZGENE, UniProtKB/TrEMBL
	A6HDB2	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEM0	ENTREZGENE, UniProtKB/TrEMBL
	P23571	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Mpg	N-methylpurine-DNA glycocylase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_protein	253 amino acid residues	728922

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)