Advanced Search (OLGA)

Gene: Mos (MOS proto-oncogene, serine/threonine kinase) Rattus norvegicus

Analyze

Symbol:

Mos

Name:

MOS proto-oncogene, serine/threonine kinase

RGD ID:

3103

Description:

Enables MRF binding activity; protein serine kinase activity; and protein serine/threonine kinase activity. Involved in several processes, including cellular response to cAMP; meiotic cell cycle process involved in oocyte maturation; and spermatocyte division. Located in cytosol. Orthologous to human MOS (MOS proto-oncogene, serine/threonine kinase); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

c-mos; Moloney murine sarcoma viral (v-mos) oncogene homolog; Moloney sarcoma oncogene; oocyte maturation factor mos; proto-oncogene c-Mos; proto-oncogene serine/threonine-protein kinase mos; v-mos moloney murine sarcoma viral oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MOS (MOS proto-oncogene, serine/threonine kinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Mos (Moloney sarcoma oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mos (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MOS (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MOS (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mos (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MOS (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MOS (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mos (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mos (MOS proto-oncogene, serine/threonine kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Mos (Moloney sarcoma oncogene)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MOS (MOS proto-oncogene, serine/threonine kinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mos (v-mos Moloney murine sarcoma viral oncogene homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mos	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Mos	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	mos	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mos	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	21,657,549 - 21,658,856 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	21,657,431 - 21,658,987 (-)	Ensembl				GRCr8
mRatBN7.2	5	16,859,957 - 16,861,264 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	16,859,957 - 16,861,264 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	19,101,026 - 19,102,333 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	20,699,515 - 20,700,822 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	20,451,008 - 20,452,315 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	16,746,085 - 16,747,392 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	16,746,197 - 16,747,222 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	21,526,047 - 21,527,345 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	17,158,906 - 17,160,204 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	16,224,269 - 16,225,576 (-)	NCBI		Celera
RGSC_v3.1	5	17,157,660 - 17,160,891 (-)	NCBI
Cytogenetic Map	5	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Female Infertility (ISO)

Oocyte/Zygote/Embryo Maturation Arrest 20 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-vinylcyclohexene dioxide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

cisplatin (ISO)

dioxygen (ISO)

flavonoids (EXP)

fulvestrant (ISO)

lead diacetate (ISO)

methoxychlor (ISO)

quercetin (ISO)

resveratrol (ISO)

simazine (ISO)

Theaflavin 3,3'-digallate (ISO)

tipifarnib (EXP)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to cAMP (IEP)

cellular response to nerve growth factor stimulus (IEP)

chromatin organization (IEA,ISO,ISS)

ERK1 and ERK2 cascade (ISO)

establishment of meiotic spindle orientation (IEA,ISO,ISS)

intracellular signal transduction (TAS)

MAPK cascade (ISO,ISS)

meiotic cell cycle process involved in oocyte maturation (IEP)

meiotic spindle organization (IEA,ISO,ISS)

negative regulation of metaphase/anaphase transition of meiotic cell cycle (IBA,IEA,ISO,ISS)

oocyte maturation (IEA,ISO,ISS)

positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS)

positive regulation of MAPK cascade (IBA,IEA,ISO,ISS)

positive regulation of myoblast differentiation (IDA)

protein autophosphorylation (ISS)

protein phosphorylation (TAS)

regulation of meiotic nuclear division (ISO)

signal transduction (IBA)

skeletal muscle tissue development (IEP)

spermatocyte division (IEP)

spermatogenesis (NAS)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (IDA)

Molecular Function

ATP binding (IEA)

kinase activity (IEA)

MAP kinase kinase kinase activity (ISS)

MRF binding (IMP)

nucleotide binding (IEA)

protein binding (ISO)

protein kinase activity (IBA,IEA,TAS)

protein serine kinase activity (IDA,IEA)

protein serine/threonine kinase activity (IDA,IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The regulation of calcium/calmodulin-dependent protein kinase II during oocyte activation in the rat.	Ito J, etal., J Reprod Dev. 2006 Jun;52(3):439-47. doi: 10.1262/jrd.17047. Epub 2006 Apr 8.
4.	Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.	Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
5.	cAMP-Dependent PKA negatively regulates polyadenylation of c-mos mRNA in rat oocytes.	Lazar S, etal., Mol Endocrinol 2002 Feb;16(2):331-41.
6.	Direct relationship between the expression of tumor suppressor H19 mRNA and c-mos proto-oncogene during myogenesis.	Leibovitch MP, etal., Oncogene. 1995 Jan 19;10(2):251-60.
7.	Rat myogenic c-mos cDNA: cloning sequence analysis and regulation during muscle development.	Leibovitch SA, etal., Oncogene 1990 Aug;5(8):1149-57.
8.	p34cdc2 protein is complexed with the c-mos protein in rat skeletal muscle.	Leibovitch SA, etal., Oncogene. 1993 Sep;8(9):2361-9.
9.	Mos activates myogenic differentiation by promoting heterodimerization of MyoD and E12 proteins.	Lenormand JL, etal., Mol Cell Biol. 1997 Feb;17(2):584-93. doi: 10.1128/MCB.17.2.584.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Definitive expression of c-mos in late meiotic prophase leads to phosphorylation of a 34 kda protein in cultured rat spermatocytes.	Nagao Y Cell Biol Int 2002;26(2):193-201.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	Cytostatic factor proteins are present in male meiotic cells and beta-nerve growth factor increases mos levels in rat late spermatocytes.	Perrard MH, etal., PLoS One. 2009 Oct 5;4(10):e7237. doi: 10.1371/journal.pone.0007237.
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	GOA pipeline	RGD automated data pipeline
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	Complete c-mos (rat) nucleotide sequence: presence of conserved domains in c-mos proteins.	van der Hoorn FA and Firzlaff J, Nucleic Acids Res 1984 Feb 24;12(4):2147-56.
18.	Rat thy-1 antigens from thymus and brain: their tissue distribution, purification, and chemical composition.	Williams AF, etal., Cold Spring Harb Symp Quant Biol 1977;41 Pt 1:51-61.
19.	Biallelic mutations in MOS cause female infertility characterized by human early embryonic arrest and fragmentation.	Zhang YL, etal., EMBO Mol Med. 2021 Dec 7;13(12):e14887. doi: 10.15252/emmm.202114887. Epub 2021 Nov 15.

Additional References at PubMed

PMID:1298984	PMID:8015609	PMID:8015610	PMID:8631259	PMID:8692939	PMID:12207927	PMID:12533425	PMID:19550110	PMID:20724447

Genomics

Comparative Map Data

Mos
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	21,657,549 - 21,658,856 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	21,657,431 - 21,658,987 (-)	Ensembl				GRCr8
mRatBN7.2	5	16,859,957 - 16,861,264 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	16,859,957 - 16,861,264 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	19,101,026 - 19,102,333 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	20,699,515 - 20,700,822 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	20,451,008 - 20,452,315 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	16,746,085 - 16,747,392 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	16,746,197 - 16,747,222 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	21,526,047 - 21,527,345 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	17,158,906 - 17,160,204 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	16,224,269 - 16,225,576 (-)	NCBI		Celera
RGSC_v3.1	5	17,157,660 - 17,160,891 (-)	NCBI
Cytogenetic Map	5	q12	NCBI

MOS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	56,112,942 - 56,113,982 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	56,112,942 - 56,113,982 (-)	Ensembl			hg38	GRCh38
GRCh37	8	57,025,501 - 57,026,541 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	57,188,055 - 57,189,095 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	57,188,054 - 57,189,095	NCBI
Celera	8	53,016,252 - 53,017,292 (-)	NCBI		Celera
Cytogenetic Map	8	q12.1	NCBI
HuRef	8	52,492,986 - 52,494,026 (-)	NCBI		HuRef
CHM1_1	8	57,077,104 - 57,078,144 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	56,489,918 - 56,490,958 (-)	NCBI		T2T-CHM13v2.0

Mos
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	3,870,658 - 3,872,105 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	3,870,657 - 3,872,105 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	3,870,658 - 3,872,105 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	3,870,657 - 3,872,105 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	3,797,805 - 3,799,252 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	3,797,930 - 3,799,104 (-)	NCBI		MGSCv36	mm8
Celera	4	3,827,056 - 3,828,607 (-)	NCBI		Celera
Cytogenetic Map	4	A1	NCBI
cM Map	4	2.16	NCBI

Mos
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955454	15,193,132 - 15,194,268 (-)	NCBI	ChiLan1.0	ChiLan1.0

MOS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	71,770,387 - 71,771,734 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	47,494,891 - 47,496,185 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	52,559,066 - 52,560,362 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	49,930,077 - 49,931,117 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	49,930,077 - 49,931,117 (-)	Ensembl			panPan2	panpan1.1

MOS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	7,510,987 - 7,513,180 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	7,823,723 - 7,826,339 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	7,585,329 - 7,589,193 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	7,585,443 - 7,586,489 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	7,599,834 - 7,602,449 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	7,731,622 - 7,735,488 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	8,008,489 - 8,012,354 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mos
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	72,020,606 - 72,021,655 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936496	2,763,822 - 2,764,871 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936496	2,763,822 - 2,764,871 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MOS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	75,739,402 - 75,741,076 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	75,739,402 - 75,741,076 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	82,657,132 - 82,658,806 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MOS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	52,150,113 - 52,152,390 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	52,150,237 - 52,151,274 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	89,647,409 - 89,648,911 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mos
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624886	3,934,192 - 3,935,220 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624886	3,934,081 - 3,935,341 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mos
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	72,855,401 - 72,857,378 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mos
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	171
Count of miRNA genes:	130
Interacting mature miRNAs:	140
Transcripts:	ENSRNOT00000011602
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	13731153	43590997	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	8627230	52665523	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	14606078	59606078	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	17576633	62576633	Rat
1578774	Tcas8	Tongue tumor susceptibility QTL 8	3.47		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	15707451	60707451	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
2312562	Pur18	Proteinuria QTL 18	2.6	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	5	6922282	37468560	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	17486080	62486080	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
631827	Alc4	Alcohol consumption QTL 4	3.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	5	12970480	25683802	Rat
2303577	Gluco47	Glucose level QTL 47	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	16520019	61520019	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	17486080	62486080	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	8627230	53627230	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	6	54	126	43	49	25	13	25	5	168	82	7	109	51	80	24	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_020102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473984	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X00422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X52952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011602 ⟹ ENSRNOP00000064243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	21,657,431 - 21,658,987 (-)	Ensembl
mRatBN7.2 Ensembl	5	16,859,957 - 16,861,264 (-)	Ensembl
Rnor_6.0 Ensembl	5	16,746,197 - 16,747,222 (-)	Ensembl

RefSeq Acc Id:

NM_020102 ⟹ NP_064487

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	21,657,549 - 21,658,856 (-)	NCBI
mRatBN7.2	5	16,859,957 - 16,861,264 (-)	NCBI
Rnor_6.0	5	16,746,085 - 16,747,392 (-)	NCBI
Rnor_5.0	5	21,526,047 - 21,527,345 (-)	NCBI
RGSC_v3.4	5	17,158,906 - 17,160,204 (-)	RGD
Celera	5	16,224,269 - 16,225,576 (-)	NCBI

Sequence:

show sequence

ACCTTGCTGAGCAGCAAGACGTGAGAGCACAGTTGTGGCTGGTTTTGAGAATACAAGAAGAAGG
GAAATGGGATGAAGGCGGAAACCTTCAGCCATGCTTCCAAACTTCCCTGGGTGTTCCTGGTCAT
TTCTCTCTAGCGTCTCTTGTGACTGTCCCATCTGAGGGTGTAATGCCTTCGCCTCTCATCCTGT
GTCGCTACCTCCCTCGCGAGCTGTCGCCAACGGTGGACTCGAGGTCCTGCAGCAGCCCCTTGGT
GGCCTCGAGGAAGGCGGGGAAGTTCCTGGGGGCCACTCCTCCTCGGGCCCCGCGGCTGTCACGC
CGGCTGGCCTGGTGCTTCATAGACTGGGGACAGGTATGCCTGCTGCATAGGCTGGGTTCTGGAG
GGTTTGGCTCGGTGTACAAAGCCACTTACCACGGTGTTCCTGTGGCCATCAAGCAAGTGAACAA
GTGCACCAGGAACCTACGTGCATCCCAGCGGAGTTTCTGGGCTGAACTGAACATTGCAAGGCTG
CACCACGACAACATAGTCCGGGTTGTGGCTGCCAGCACGCGCACGCCGGAAGGTTCCAACAGCC
TTGGTACCATAATCATGGAGTTTGGGGGCAATGTGACTCTACACCAAGTCATCTACGGTGCCAC
CCGCTCCCCAGAGCCTCTCAGCTGCAGAGAGCAACTGAGTTTGGGAAAGTGCCTCAAGTATTCC
CTAGATATTGTTAACGGCCTGCTTTTTCTCCACTCACAAAGCATTTTGCACTTGGACCTGAAGC
CAGCGAACATTTTGATCAGTGAGAAGGACGTTTGTAAGATAAGTGACTTCGGCTGCTCCCAGAA
GCTTCAGGATCTGCGGTGCCGGCAGGCGTCCCTTCACCACATCGGGGGCACGTACACGCACCAA
GCTCCGGAGCTCCTGAAAGGAGAGATCGCCACGCCCAAAGCCGACATCTACTCTTTTGGCATCA
CCCTGTGGCAGATGACCACCAGGGAGGTGCCTTACTCCGGCGAGCCTCAGTACGTGCAGTACGC
AGTGGTAGCCTACAATCTGCGCCCGTCACTGGCAGGGGCGGTGTTCACCGCCTCCCTGACTGGG
AAGACGCTGCAGAACATCGTCCAGAGCTGCTGGGAGGCCCGCGCCCTGCAGAGGCCGGGTGCAG
AACTGCTCCAGAAGGACCTGAAGGCTTTCCGAGGGGCACTGGGCTGACTCCATCGAGCCTGTGT
GCAGATAAGCTTTTCGTTTCTGTTTATTTTTAAATAAGTAAGGATGGGCTTTTAGGGCATATTT
TTAGAAAATAAAGTTACTACAAACTTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_064487	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA25123	(Get FASTA)	NCBI Sequence Viewer
	CAA37128	(Get FASTA)	NCBI Sequence Viewer
	EDM11614	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064243
GenBank Protein	P00539	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_064487 ⟸ NM_020102

- UniProtKB:

P00539 (UniProtKB/Swiss-Prot), M0R4F9 (UniProtKB/TrEMBL), A6JFL8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPSPLILCRYLPRELSPTVDSRSCSSPLVASRKAGKFLGATPPRAPRLSRRLAWCFIDWGQVCL
LHRLGSGGFGSVYKATYHGVPVAIKQVNKCTRNLRASQRSFWAELNIARLHHDNIVRVVAASTR
TPEGSNSLGTIIMEFGGNVTLHQVIYGATRSPEPLSCREQLSLGKCLKYSLDIVNGLLFLHSQS
ILHLDLKPANILISEKDVCKISDFGCSQKLQDLRCRQASLHHIGGTYTHQAPELLKGEIATPKA
DIYSFGITLWQMTTREVPYSGEPQYVQYAVVAYNLRPSLAGAVFTASLTGKTLQNIVQSCWEAR
ALQRPGAELLQKDLKAFRGALG

hide sequence

Ensembl Acc Id:

ENSRNOP00000064243 ⟸ ENSRNOT00000011602

Protein Domains

Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P00539-F1-model_v2	AlphaFold	P00539	1-339	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3103	AgrOrtholog
BioCyc Gene	G2FUF-42115	BioCyc
Ensembl Genes	ENSRNOG00000008567	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000011602	ENTREZGENE
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
	Ser/Thr_Kinases-Pseudokinases	UniProtKB/Swiss-Prot
NCBI Gene	24559	ENTREZGENE
PANTHER	SERINE/THREONINE-PROTEIN KINASE TNNI3K-RELATED	UniProtKB/Swiss-Prot
	V-MOS MOLONEY MURINE SARCOMA VIRAL ONCO HOMOLOG	UniProtKB/Swiss-Prot
Pfam	Pkinase	UniProtKB/Swiss-Prot
PhenoGen	Mos	PhenoGen
PROSITE	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008567	RatGTEx
SMART	S_TKc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot
UniProt	A6JFL8	ENTREZGENE, UniProtKB/TrEMBL
	M0R4F9	ENTREZGENE, UniProtKB/TrEMBL
	MOS_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Mos	MOS proto-oncogene, serine/threonine kinase	Mos	Moloney sarcoma oncogene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Mos	Moloney sarcoma oncogene	Mos	v-mos moloney murine sarcoma viral oncogene homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Mos	v-mos moloney murine sarcoma viral oncogene homolog			Symbol and Name status set to approved	1299863	APPROVED
2002-06-10	Mos	v-mos moloney murine sarcoma viral oncogene homolog			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression highest in skeletal muscle, heart, and brain; expression in cardiac ventricle increases after birth	70317
gene_function	phosphorylates and activates Map2k1	70317
gene_product	mitogen activated protein kinase kinase kinase	70317
gene_protein	43 kDa	70317

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)