Symbol:
Mdh1
Name:
malate dehydrogenase 1
RGD ID:
3072
Description:
Enables L-malate dehydrogenase (NAD+) activity and NAD binding activity. Involved in dicarboxylic acid metabolic process and nicotinamide nucleotide metabolic process. Predicted to be located in centrosome and cytoplasm. Predicted to be active in cytosol. Human ortholog(s) of this gene implicated in developmental and epileptic encephalopathy 88. Orthologous to human MDH1 (malate dehydrogenase 1); PARTICIPATES IN Leigh disease pathway; nicotinamide adenine dinucleotide metabolic pathway; primary hyperoxaluria type 2 pathway; INTERACTS WITH 1-benzylpiperazine; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
aromatic alpha-keto acid reductase; cytosolic malate dehydrogenase; KAR; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase soluble; malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal; malate dehydrogenase, soluble; Malate dehydrogenase-like enzyme; Mdhl; MDL1; Mor2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MDH1 (malate dehydrogenase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mdh1 (malate dehydrogenase 1, NAD (soluble)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mdh1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MDH1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MDH1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mdh1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MDH1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MDH1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mdh1 (malate dehydrogenase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MDH1 (malate dehydrogenase 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mdh1 (malate dehydrogenase 1, NAD (soluble))
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mdh1aa (malate dehydrogenase 1Aa, NAD (soluble))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
mdh-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Mdh1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mdh1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 99,831,934 - 99,847,227 (-) NCBI GRCr8 mRatBN7.2 14 95,630,625 - 95,645,920 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 95,630,306 - 95,645,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 99,982,791 - 99,997,990 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 101,223,133 - 101,238,332 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 97,696,668 - 97,711,868 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 106,378,349 - 106,393,642 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 106,378,942 - 106,393,670 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 106,449,337 - 106,463,995 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 102,259,130 - 102,273,788 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 102,278,343 - 102,292,999 (-) NCBI Celera 14 94,639,971 - 94,655,156 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mdh1 Rat (-)-epigallocatechin 3-gallate decreases expression ISO MDH1 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of MDH1 protein CTD PMID:31195006 Mdh1 Rat (1->4)-beta-D-glucan multiple interactions ISO Mdh1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MDH1 mRNA CTD PMID:36331819 Mdh1 Rat 1,2-dimethylhydrazine decreases expression ISO Mdh1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MDH1 mRNA CTD PMID:22206623 Mdh1 Rat 1,2-dimethylhydrazine multiple interactions ISO Mdh1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MDH1 mRNA CTD PMID:22206623 Mdh1 Rat 1-benzylpiperazine decreases expression EXP 6480464 N-benzylpiperazine results in decreased expression of MDH1 mRNA CTD PMID:26821219 Mdh1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of MDH1 mRNA CTD PMID:25380136 Mdh1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MDH1 mRNA CTD PMID:26496021 Mdh1 Rat 17beta-estradiol decreases expression ISO Mdh1 (Mus musculus) 6480464 Estradiol results in decreased expression of MDH1 mRNA CTD PMID:39298647 Mdh1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MDH1 mRNA CTD PMID:32145629 Mdh1 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of MDH1 protein] CTD PMID:21136691 Mdh1 Rat 2,3,7,8-tetrabromodibenzodioxine increases expression ISO Mdh1 (Mus musculus) 6480464 2 more ... CTD PMID:27604104 Mdh1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MDH1 mRNA CTD PMID:19490992 and PMID:34747641 Mdh1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MDH1 mRNA CTD PMID:21215274 and PMID:21724226 Mdh1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mdh1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MDH1 mRNA CTD PMID:21570461 Mdh1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MDH1 mRNA CTD PMID:22298810 Mdh1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Mdh1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Mdh1 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of MDH1 protein CTD PMID:19033394 Mdh1 Rat 2,6-dimethoxyphenol multiple interactions ISO MDH1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Mdh1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of MDH1 mRNA CTD PMID:30071829 Mdh1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of MDH1 protein and alpha-Chlorohydrin results in decreased expression of MDH1 protein CTD PMID:26597043 Mdh1 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of MDH1 mRNA CTD PMID:19162173 Mdh1 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of MDH1 mRNA CTD PMID:25380136 Mdh1 Rat 4,4'-sulfonyldiphenol increases expression ISO Mdh1 (Mus musculus) 6480464 bisphenol S results in increased expression of MDH1 mRNA CTD PMID:39298647 Mdh1 Rat 4,4'-sulfonyldiphenol increases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol S results in increased expression of MDH1 protein CTD PMID:34186270 Mdh1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MDH1 mRNA CTD PMID:30047161 and PMID:36843608 Mdh1 Rat 7H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of MDH1 protein CTD PMID:19464573 Mdh1 Rat 8-Br-cAMP increases expression ISO MDH1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of MDH1 mRNA CTD PMID:22079614 Mdh1 Rat 9H-xanthine multiple interactions EXP 6480464 [Xanthine co-treated with XDH protein] results in decreased expression of MDH1 protein CTD PMID:19464573 Mdh1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of MDH1 mRNA CTD PMID:31881176 Mdh1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of MDH1 mRNA CTD PMID:28959563 Mdh1 Rat aflatoxin B1 multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of MDH1 mRNA CTD PMID:25450479 Mdh1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of MDH1 mRNA CTD PMID:24349266 Mdh1 Rat aldehydo-D-glucose increases expression ISO MDH1 (Homo sapiens) 6480464 Glucose deficiency results in increased expression of MDH1 mRNA CTD PMID:26811028 Mdh1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MDH1 mRNA CTD PMID:35163327 Mdh1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MDH1 mRNA CTD PMID:30047161 Mdh1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MDH1 mRNA CTD PMID:16483693 Mdh1 Rat arsenite(3-) multiple interactions ISO MDH1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to MDH1 mRNA] CTD PMID:32406909 Mdh1 Rat arsenous acid multiple interactions ISO MDH1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to MDH1 protein] CTD PMID:26598702 Mdh1 Rat atrazine increases expression ISO MDH1 (Homo sapiens) 6480464 Atrazine results in increased expression of MDH1 mRNA CTD PMID:22378314 Mdh1 Rat benzatropine decreases expression ISO MDH1 (Homo sapiens) 6480464 Benztropine results in decreased expression of MDH1 protein CTD PMID:34122009 Mdh1 Rat benzo[a]pyrene increases expression ISO Mdh1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MDH1 mRNA CTD PMID:22228805 Mdh1 Rat benzo[a]pyrene multiple interactions ISO Mdh1 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of MDH1 mRNA] CTD PMID:22228805 Mdh1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of MDH1 mRNA CTD PMID:18164116 Mdh1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Mdh1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of MDH1 protein CTD PMID:28934723 Mdh1 Rat bisphenol A increases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol A results in increased expression of MDH1 mRNA and bisphenol A results in increased expression of MDH1 protein CTD PMID:25047013 and PMID:37567409 Mdh1 Rat bisphenol A decreases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MDH1 protein CTD PMID:34186270 Mdh1 Rat bisphenol A affects expression ISO MDH1 (Homo sapiens) 6480464 bisphenol A affects the expression of MDH1 mRNA CTD PMID:30903817 Mdh1 Rat bisphenol A increases expression ISO Mdh1 (Mus musculus) 6480464 bisphenol A results in increased expression of MDH1 mRNA and bisphenol A results in increased expression of MDH1 protein CTD PMID:24909818 and PMID:33221593 Mdh1 Rat bisphenol A decreases expression ISO Mdh1 (Mus musculus) 6480464 bisphenol A results in decreased expression of MDH1 protein CTD PMID:24909818 and PMID:35999755 Mdh1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MDH1 mRNA CTD PMID:25181051 Mdh1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MDH1 mRNA CTD PMID:26982218 more ... Mdh1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of MDH1 mRNA CTD PMID:26496021 Mdh1 Rat bisphenol AF increases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of MDH1 protein CTD PMID:34186270 Mdh1 Rat Bisphenol B increases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol B results in increased expression of MDH1 protein CTD PMID:34186270 Mdh1 Rat bisphenol F increases expression ISO Mdh1 (Mus musculus) 6480464 bisphenol F results in increased expression of MDH1 mRNA CTD PMID:38685157 Mdh1 Rat bisphenol F increases expression ISO MDH1 (Homo sapiens) 6480464 bisphenol F results in increased expression of MDH1 protein CTD PMID:34186270 Mdh1 Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [Dietary Fats results in decreased expression of MDH1 protein] CTD PMID:20359164 Mdh1 Rat carbon nanotube decreases expression ISO Mdh1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Mdh1 Rat chloropicrin increases expression ISO MDH1 (Homo sapiens) 6480464 chloropicrin results in increased expression of MDH1 mRNA CTD PMID:26352163 Mdh1 Rat chlorpyrifos increases methylation EXP 6480464 Chlorpyrifos results in increased methylation of MDH1 gene CTD PMID:32905263 Mdh1 Rat choline multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of MDH1 protein CTD PMID:19566968 Mdh1 Rat chromium trinitrate increases expression ISO Mdh1 (Mus musculus) 6480464 chromium nitrate results in increased expression of MDH1 protein CTD PMID:22144121 Mdh1 Rat ciguatoxin CTX1B affects expression ISO Mdh1 (Mus musculus) 6480464 Ciguatoxins affects the expression of MDH1 mRNA CTD PMID:18353800 Mdh1 Rat cisplatin increases expression ISO MDH1 (Homo sapiens) 6480464 Cisplatin results in increased expression of MDH1 mRNA CTD PMID:27392435 Mdh1 Rat clobetasol increases expression ISO Mdh1 (Mus musculus) 6480464 Clobetasol results in increased expression of MDH1 mRNA CTD PMID:27462272 Mdh1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of MDH1 protein CTD PMID:16470657 Mdh1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of MDH1 mRNA CTD PMID:17602206 Mdh1 Rat clozapine decreases expression ISO MDH1 (Homo sapiens) 6480464 Clozapine results in decreased expression of MDH1 protein CTD PMID:34122009 Mdh1 Rat cocaine decreases expression ISO MDH1 (Homo sapiens) 6480464 Cocaine results in decreased expression of MDH1 mRNA CTD PMID:12629581 Mdh1 Rat copper atom decreases expression ISO Mdh1 (Mus musculus) 6480464 Copper results in decreased expression of MDH1 protein CTD PMID:23882024 Mdh1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of MDH1 mRNA CTD PMID:22465980 Mdh1 Rat copper(0) decreases expression ISO Mdh1 (Mus musculus) 6480464 Copper results in decreased expression of MDH1 protein CTD PMID:23882024 Mdh1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of MDH1 mRNA CTD PMID:22465980 Mdh1 Rat copper(II) sulfate decreases expression ISO MDH1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MDH1 mRNA CTD PMID:19549813 Mdh1 Rat crocidolite asbestos decreases expression ISO Mdh1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of MDH1 mRNA CTD PMID:29279043 Mdh1 Rat CU-O LINKAGE decreases expression ISO Mdh1 (Mus musculus) 6480464 cupric oxide analog results in decreased expression of MDH1 protein CTD PMID:23882024 Mdh1 Rat cyclosporin A decreases expression ISO MDH1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MDH1 mRNA CTD PMID:20106945 more ... Mdh1 Rat D-gluconic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of MDH1 mRNA CTD PMID:16556975 Mdh1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of MDH1 mRNA CTD PMID:24349266 Mdh1 Rat D-glucose increases expression ISO MDH1 (Homo sapiens) 6480464 Glucose deficiency results in increased expression of MDH1 mRNA CTD PMID:26811028 Mdh1 Rat deoxycholic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of MDH1 mRNA CTD PMID:16556975 Mdh1 Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride and Dietary co-treated with Potassium Chloride] results in decreased expression of MDH1 mRNA CTD PMID:22228705 Mdh1 Rat dexamethasone decreases expression ISO Mdh1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of MDH1 protein CTD PMID:33567340 Mdh1 Rat dexamethasone increases expression ISO MDH1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of MDH1 mRNA CTD PMID:25047013 Mdh1 Rat dextran sulfate decreases expression ISO Mdh1 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of MDH1 protein CTD PMID:35999755 Mdh1 Rat diarsenic trioxide multiple interactions ISO MDH1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to MDH1 protein] CTD PMID:26598702 Mdh1 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of MDH1 protein CTD PMID:26721910 Mdh1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MDH1 mRNA CTD PMID:21266533 Mdh1 Rat dicrotophos decreases expression ISO MDH1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MDH1 mRNA CTD PMID:28302478 Mdh1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of MDH1 mRNA CTD PMID:37077353 Mdh1 Rat dihydroartemisinin affects binding ISO MDH1 (Homo sapiens) 6480464 artenimol analog binds to MDH1 protein CTD PMID:26340163 Mdh1 Rat dinophysistoxin 1 decreases expression ISO MDH1 (Homo sapiens) 6480464 dinophysistoxin 1 results in decreased expression of MDH1 mRNA CTD PMID:28939011 Mdh1 Rat dioscin multiple interactions ISO Mdh1 (Mus musculus) 6480464 dioscin inhibits the reaction [Acetaminophen results in decreased expression of MDH1 protein] CTD PMID:22939915 Mdh1 Rat dioxygen decreases expression ISO Mdh1 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of MDH1 protein CTD PMID:25937538 Mdh1 Rat disodium selenite increases expression ISO MDH1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MDH1 mRNA CTD PMID:18175754 Mdh1 Rat dorsomorphin multiple interactions ISO MDH1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mdh1 Rat doxorubicin decreases expression ISO MDH1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MDH1 mRNA CTD PMID:29803840 Mdh1 Rat enzyme inhibitor multiple interactions ISO MDH1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MDH1 protein CTD PMID:23301498 Mdh1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of MDH1 protein CTD PMID:23702218 Mdh1 Rat ethanol increases expression ISO Mdh1 (Mus musculus) 6480464 Ethanol results in increased expression of MDH1 mRNA CTD PMID:30319688 Mdh1 Rat ethanol affects splicing ISO Mdh1 (Mus musculus) 6480464 Ethanol affects the splicing of MDH1 mRNA CTD PMID:30319688 Mdh1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of MDH1 mRNA CTD PMID:18035473 Mdh1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MDH1 mRNA and Flutamide results in increased expression of MDH1 protein CTD PMID:17311803 more ... Mdh1 Rat folic acid multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of MDH1 protein CTD PMID:19566968 Mdh1 Rat folic acid multiple interactions ISO Mdh1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MDH1 mRNA CTD PMID:22206623 Mdh1 Rat folic acid decreases expression ISO Mdh1 (Mus musculus) 6480464 Folic Acid results in decreased expression of MDH1 mRNA CTD PMID:25629700 Mdh1 Rat formaldehyde decreases expression ISO MDH1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MDH1 mRNA CTD PMID:20655997 Mdh1 Rat FR900359 affects phosphorylation ISO MDH1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MDH1 protein CTD PMID:37730182 Mdh1 Rat furan affects binding EXP 6480464 furan binds to MDH1 protein CTD PMID:22240984 Mdh1 Rat furfural multiple interactions ISO MDH1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Mdh1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MDH1 mRNA CTD PMID:22061828 Mdh1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of MDH1 mRNA CTD PMID:24349266 Mdh1 Rat glucose increases expression ISO MDH1 (Homo sapiens) 6480464 Glucose deficiency results in increased expression of MDH1 mRNA CTD PMID:26811028 Mdh1 Rat hydrogen peroxide multiple interactions ISO MDH1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of MDH1 protein CTD PMID:18951874 Mdh1 Rat hydrogen peroxide decreases expression ISO MDH1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of MDH1 protein CTD PMID:34581912 Mdh1 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of MDH1 mRNA CTD PMID:36868495 Mdh1 Rat isotretinoin decreases expression ISO MDH1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of MDH1 mRNA CTD PMID:20436886 Mdh1 Rat ivermectin decreases expression ISO MDH1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MDH1 protein CTD PMID:32959892 Mdh1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of MDH1 mRNA CTD PMID:37077353 Mdh1 Rat L-methionine multiple interactions EXP 6480464 [Folic Acid deficiency co-treated with Methionine deficiency co-treated with Choline deficiency] results in increased expression of MDH1 protein CTD PMID:19566968 Mdh1 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of MDH1 mRNA CTD PMID:24136188 Mdh1 Rat malic acid increases expression ISO MDH1 (Homo sapiens) 6480464 malic acid deficiency results in increased expression of MDH1 mRNA CTD PMID:26811028 Mdh1 Rat manganese atom multiple interactions ISO Mdh1 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MDH1 mRNA CTD PMID:35690225 Mdh1 Rat manganese(0) multiple interactions ISO Mdh1 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MDH1 mRNA CTD PMID:35690225 Mdh1 Rat manganese(II) chloride multiple interactions ISO Mdh1 (Mus musculus) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MDH1 mRNA CTD PMID:35690225 Mdh1 Rat menthofuran affects binding EXP 6480464 menthofuran metabolite binds to MDH1 protein CTD PMID:23106769 Mdh1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MDH1 mRNA CTD PMID:30047161 Mdh1 Rat miconazole increases expression ISO Mdh1 (Mus musculus) 6480464 Miconazole results in increased expression of MDH1 mRNA CTD PMID:27462272 Mdh1 Rat monosodium L-glutamate multiple interactions ISO Mdh1 (Mus musculus) 6480464 [Sodium Glutamate co-treated with High Fructose Corn Syrup] results in decreased expression of MDH1 mRNA CTD PMID:20111022 Mdh1 Rat N(4)-hydroxycytidine decreases expression ISO Mdh1 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of MDH1 mRNA CTD PMID:37748715 Mdh1 Rat N-nitrosodiethylamine multiple interactions ISO Mdh1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with HRAS protein] results in increased activity of MDH1 protein CTD PMID:12499697 Mdh1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of MDH1 mRNA CTD PMID:18164116 Mdh1 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of MDH1 mRNA CTD PMID:25380136 Mdh1 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of MDH1 protein CTD PMID:19716841 Mdh1 Rat nitrates multiple interactions ISO Mdh1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MDH1 mRNA CTD PMID:35964746 Mdh1 Rat obeticholic acid increases expression ISO MDH1 (Homo sapiens) 6480464 obeticholic acid results in increased expression of MDH1 mRNA CTD PMID:27939613 Mdh1 Rat oxaloacetic acid increases expression ISO MDH1 (Homo sapiens) 6480464 Oxaloacetic Acid results in increased expression of MDH1 protein CTD PMID:26811028 Mdh1 Rat ozone multiple interactions ISO Mdh1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of MDH1 mRNA CTD PMID:34911549 Mdh1 Rat ozone multiple interactions ISO MDH1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MDH1 mRNA CTD PMID:35430440 Mdh1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of MDH1 mRNA CTD PMID:27638505 Mdh1 Rat paracetamol affects expression ISO Mdh1 (Mus musculus) 6480464 Acetaminophen affects the expression of MDH1 mRNA CTD PMID:17562736 Mdh1 Rat paracetamol decreases expression ISO MDH1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MDH1 mRNA CTD PMID:29067470 Mdh1 Rat paracetamol multiple interactions ISO Mdh1 (Mus musculus) 6480464 dioscin inhibits the reaction [Acetaminophen results in decreased expression of MDH1 protein] CTD PMID:22939915 Mdh1 Rat paracetamol decreases expression ISO Mdh1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of MDH1 protein CTD PMID:22939915 Mdh1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of MDH1 mRNA CTD PMID:15084756 Mdh1 Rat perfluorododecanoic acid increases expression EXP 6480464 perfluorododecanoic acid results in increased expression of MDH1 protein CTD PMID:26168851 Mdh1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Mdh1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of MDH1 mRNA CTD PMID:19429403 Mdh1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mdh1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of MDH1 mRNA CTD PMID:36331819 Mdh1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Mdh1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of MDH1 protein CTD PMID:26178269 Mdh1 Rat perfluorooctanoic acid affects expression ISO Mdh1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of MDH1 mRNA CTD PMID:19429403 Mdh1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of MDH1 mRNA CTD PMID:35163327 Mdh1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of MDH1 mRNA CTD PMID:19162173 Mdh1 Rat potassium chloride multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride and Dietary co-treated with Potassium Chloride] results in decreased expression of MDH1 mRNA CTD PMID:22228705 Mdh1 Rat potassium chromate increases expression ISO Mdh1 (Mus musculus) 6480464 potassium chromate(VI) results in increased expression of MDH1 protein CTD PMID:22144121 Mdh1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of MDH1 mRNA CTD PMID:19162173 Mdh1 Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of MDH1 mRNA CTD PMID:30047161 Mdh1 Rat quercetin decreases expression ISO MDH1 (Homo sapiens) 6480464 Quercetin results in decreased expression of MDH1 protein CTD PMID:19207037 Mdh1 Rat SB 431542 multiple interactions ISO MDH1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mdh1 Rat silicon dioxide affects secretion ISO MDH1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of MDH1 protein CTD PMID:25895662 Mdh1 Rat silver atom decreases expression ISO Mdh1 (Mus musculus) 6480464 Silver results in decreased expression of MDH1 mRNA CTD PMID:27131904 Mdh1 Rat silver(0) decreases expression ISO Mdh1 (Mus musculus) 6480464 Silver results in decreased expression of MDH1 mRNA CTD PMID:27131904 Mdh1 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of MDH1 protein CTD PMID:20217863 Mdh1 Rat sodium chloride multiple interactions ISO MDH1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of MDH1 protein more ... CTD PMID:38598786 Mdh1 Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of MDH1 mRNA CTD PMID:25993096 Mdh1 Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of MDH1 protein] CTD PMID:21136691 Mdh1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of MDH1 protein CTD PMID:21136691 Mdh1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MDH1 mRNA CTD PMID:30047161 Mdh1 Rat sulforaphane multiple interactions EXP 6480464 [sulforaphane co-treated with Aflatoxin B1] affects the expression of MDH1 mRNA CTD PMID:25450479 Mdh1 Rat sulforaphane increases expression ISO Mdh1 (Mus musculus) 6480464 sulforaphane results in increased expression of MDH1 mRNA CTD PMID:30529165 Mdh1 Rat T-2 toxin affects expression EXP 6480464 T-2 Toxin affects the expression of MDH1 protein CTD PMID:26141394 Mdh1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of MDH1 mRNA CTD PMID:31150632 Mdh1 Rat tetrachloromethane decreases expression ISO Mdh1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MDH1 mRNA CTD PMID:31919559 Mdh1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of MDH1 protein CTD PMID:35544339 Mdh1 Rat theophylline multiple interactions ISO MDH1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of MDH1 protein CTD PMID:18951874 Mdh1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of MDH1 mRNA CTD PMID:34492290 Mdh1 Rat thiram decreases expression ISO MDH1 (Homo sapiens) 6480464 Thiram results in decreased expression of MDH1 mRNA CTD PMID:38568856 Mdh1 Rat titanium dioxide decreases expression ISO Mdh1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of MDH1 mRNA CTD PMID:23557971 Mdh1 Rat titanium dioxide affects expression ISO Mdh1 (Mus musculus) 6480464 titanium dioxide affects the expression of MDH1 mRNA CTD PMID:17656681 Mdh1 Rat trichostatin A increases expression ISO MDH1 (Homo sapiens) 6480464 trichostatin A results in increased expression of MDH1 mRNA CTD PMID:24935251 Mdh1 Rat trichostatin A multiple interactions ISO MDH1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MDH1 mRNA CTD PMID:27188386 Mdh1 Rat triclosan decreases expression ISO MDH1 (Homo sapiens) 6480464 Triclosan results in decreased expression of MDH1 mRNA CTD PMID:30510588 Mdh1 Rat valdecoxib decreases expression EXP 6480464 valdecoxib results in decreased expression of MDH1 mRNA CTD PMID:24136188 Mdh1 Rat valproic acid decreases methylation ISO MDH1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of MDH1 gene CTD PMID:29154799 Mdh1 Rat valproic acid multiple interactions ISO MDH1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MDH1 mRNA CTD PMID:27188386 Mdh1 Rat valproic acid affects expression ISO MDH1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MDH1 mRNA CTD PMID:25979313 Mdh1 Rat valproic acid increases expression ISO MDH1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MDH1 mRNA CTD PMID:19101580 more ... Mdh1 Rat valproic acid affects expression ISO Mdh1 (Mus musculus) 6480464 Valproic Acid affects the expression of MDH1 mRNA CTD PMID:17292431 Mdh1 Rat vancomycin increases expression ISO Mdh1 (Mus musculus) 6480464 Vancomycin results in increased expression of MDH1 mRNA CTD PMID:18930951 Mdh1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of MDH1 mRNA CTD PMID:23034163
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-benzylpiperazine (EXP) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2,2-tetramine (EXP) 2,3,7,8-tetrabromodibenzodioxine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7H-xanthine (EXP) 8-Br-cAMP (ISO) 9H-xanthine (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (EXP) aldehydo-D-glucose (EXP,ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) capsaicin (EXP) carbon nanotube (ISO) chloropicrin (ISO) chlorpyrifos (EXP) choline (EXP) chromium trinitrate (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clobetasol (ISO) clofibrate (EXP) clofibric acid (EXP) clozapine (ISO) cocaine (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) D-gluconic acid (EXP) D-glucose (EXP,ISO) deoxycholic acid (EXP) Deoxycorticosterone acetate (EXP) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (EXP) dihydroartemisinin (ISO) dinophysistoxin 1 (ISO) dioscin (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) flavonoids (EXP) flutamide (EXP) folic acid (EXP,ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) glucose (EXP,ISO) hydrogen peroxide (ISO) indometacin (EXP) isotretinoin (ISO) ivermectin (ISO) ketoconazole (EXP) L-methionine (EXP) leflunomide (EXP) malic acid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menthofuran (EXP) methimazole (EXP) miconazole (ISO) monosodium L-glutamate (ISO) N(4)-hydroxycytidine (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-nitrosomorpholine (EXP) nitrates (ISO) obeticholic acid (ISO) oxaloacetic acid (ISO) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) perfluorododecanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (EXP) potassium chloride (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (EXP) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (EXP) sodium chloride (ISO) sodium dichromate (EXP) streptozocin (EXP) sulfadimethoxine (EXP) sulforaphane (EXP,ISO) T-2 toxin (EXP) tetrachloromethane (EXP,ISO) thapsigargin (EXP) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triclosan (ISO) valdecoxib (EXP) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Glutamine and ornithine alpha-ketoglutarate supplementation on malate dehydrogenases expression in hepatectomized rats.
Guimarães Filho A, etal., Acta Cir Bras. 2014 Jun;29(6):365-70.
4.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
5.
Neuronal and astrocytic shuttle mechanisms for cytosolic-mitochondrial transfer of reducing equivalents: current evidence and pharmacological tools.
McKenna MC, etal., Biochem Pharmacol. 2006 Feb 14;71(4):399-407. Epub 2005 Dec 20.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Receptor-mediated endocytosis of lactate dehydrogenase M4 by liver macrophages: a mechanism for elimination of enzymes from plasma. Evidence for competition by creatine kinase MM, adenylate kinase, malate, and alcohol dehydrogenase.
Smit MJ, etal., J Biol Chem 1987 Sep 25;262(27):13020-6.
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
Role of NADH shuttles in glucose-induced insulin secretion from fetal beta-cells.
Tan C, etal., Diabetes. 2002 Oct;51(10):2989-96.
14.
Effect of Anabolic Steroid Nandrolone Decanoate on the Properties of Certain Enzymes in the Heart, Liver, and Muscle of Rats, and their Effect on Rats' Cardiac Electrophysiology.
Tylicki A, etal., Horm Metab Res. 2007 Apr;39(4):268-72.
15.
NAD+/NADH and NADP+/NADPH in cellular functions and cell death: regulation and biological consequences.
Ying W Antioxid Redox Signal. 2008 Feb;10(2):179-206.
Mdh1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 99,831,934 - 99,847,227 (-) NCBI GRCr8 mRatBN7.2 14 95,630,625 - 95,645,920 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 95,630,306 - 95,645,925 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 99,982,791 - 99,997,990 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 101,223,133 - 101,238,332 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 97,696,668 - 97,711,868 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 106,378,349 - 106,393,642 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 106,378,942 - 106,393,670 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 106,449,337 - 106,463,995 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 102,259,130 - 102,273,788 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 102,278,343 - 102,292,999 (-) NCBI Celera 14 94,639,971 - 94,655,156 (-) NCBI Celera Cytogenetic Map 14 q22 NCBI
MDH1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 63,588,963 - 63,607,197 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 63,588,609 - 63,607,197 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 63,816,097 - 63,834,331 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 63,669,626 - 63,687,832 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 63,727,772 - 63,745,979 NCBI Celera 2 63,661,163 - 63,679,336 (+) NCBI Celera Cytogenetic Map 2 p15 NCBI HuRef 2 63,556,773 - 63,575,326 (+) NCBI HuRef CHM1_1 2 63,745,880 - 63,764,431 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 63,596,617 - 63,614,818 (+) NCBI T2T-CHM13v2.0
Mdh1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 21,506,692 - 21,521,934 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 21,506,692 - 21,522,367 (-) Ensembl GRCm39 Ensembl GRCm38 11 21,556,692 - 21,571,934 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 21,556,692 - 21,572,367 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 21,456,695 - 21,471,937 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 21,456,790 - 21,471,832 (-) NCBI MGSCv36 mm8 Celera 11 23,704,959 - 23,720,201 (-) NCBI Celera Cytogenetic Map 11 A3.1 NCBI cM Map 11 13.89 NCBI
Mdh1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 20,706,058 - 20,723,493 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 20,707,765 - 20,723,493 (-) NCBI ChiLan1.0 ChiLan1.0
MDH1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 62,789,858 - 62,808,152 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 62,793,808 - 62,812,102 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 63,658,933 - 63,677,257 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 64,785,132 - 64,803,631 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 64,785,132 - 64,803,631 (+) Ensembl panpan1.1 panPan2
MDH1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 63,316,818 - 63,334,556 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 63,316,831 - 63,361,735 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 63,205,783 - 63,223,532 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 64,325,732 - 64,343,477 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 64,325,748 - 64,393,190 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 64,008,394 - 64,026,100 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 64,316,618 - 64,334,341 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 64,609,207 - 64,626,872 (+) NCBI UU_Cfam_GSD_1.0
Mdh1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 19,984,379 - 20,000,470 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936491 8,570,472 - 8,587,686 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936491 8,570,472 - 8,586,914 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MDH1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 78,244,999 - 78,268,600 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 78,247,229 - 78,263,085 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 82,274,663 - 82,280,460 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MDH1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 43,406,502 - 43,425,525 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 43,406,499 - 43,425,095 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 68,435,625 - 68,454,293 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mdh1
.
Predicted Target Of
Count of predictions: 126 Count of miRNA genes: 108 Interacting mature miRNAs: 115 Transcripts: ENSRNOT00000011429 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582201 Sffal2 Serum free fatty acids level QTL 2 4 0.0002 blood free fatty acid amount (VT:0001553) serum free fatty acids level (CMO:0000547) 14 92553886 95876975 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 631213 Bw60 Body weight QTL60 4.51 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 14 79950921 95876975 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 1582259 Gluco23 Glucose level QTL 23 3.1 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 70053989 104886043 Rat 634328 Hc5 Hypercalciuria QTL 5 2.3 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 14 58184885 103184885 Rat 1582250 Gluco26 Glucose level QTL 26 3.3 0.0009 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 73415323 95876975 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 1641900 Alcrsp11 Alcohol response QTL 11 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 14 70053989 104886043 Rat 4889951 Bss92 Bone structure and strength QTL 92 3.9 tibia area (VT:1000281) tibia-fibula cortical bone total cross-sectional area (CMO:0001721) 14 82057471 95876975 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat
Mor2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 99,834,287 - 99,834,757 (+) Marker Load Pipeline mRatBN7.2 14 95,632,978 - 95,633,448 (+) MAPPER mRatBN7.2 Rnor_6.0 14 106,380,703 - 106,381,172 NCBI Rnor6.0 Rnor_5.0 14 106,451,095 - 106,451,564 UniSTS Rnor5.0 RGSC_v3.4 14 102,260,888 - 102,261,357 UniSTS RGSC3.4 Celera 14 94,642,325 - 94,642,794 UniSTS Cytogenetic Map 14 q22 UniSTS
RH134361
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 95,631,476 - 95,632,931 (+) MAPPER mRatBN7.2 Rnor_6.0 14 106,379,201 - 106,380,655 NCBI Rnor6.0 Rnor_5.0 14 106,449,593 - 106,451,047 UniSTS Rnor5.0 RGSC_v3.4 14 102,259,386 - 102,260,840 UniSTS RGSC3.4 Celera 14 94,640,823 - 94,642,277 UniSTS Cytogenetic Map 14 q22 UniSTS
BE120360
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 95,630,523 - 95,630,634 (+) MAPPER mRatBN7.2 Rnor_6.0 14 106,378,248 - 106,378,358 NCBI Rnor6.0 Rnor_5.0 14 106,448,640 - 106,448,750 UniSTS Rnor5.0 RGSC_v3.4 14 102,258,433 - 102,258,543 UniSTS RGSC3.4 Celera 14 94,639,870 - 94,639,980 UniSTS RH 3.4 Map 14 755.8 UniSTS Cytogenetic Map 14 q22 UniSTS
D2S1567E
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 14 99,832,825 - 99,833,527 (+) Marker Load Pipeline mRatBN7.2 14 95,631,516 - 95,632,217 (+) MAPPER mRatBN7.2 Rnor_6.0 14 106,379,241 - 106,379,941 NCBI Rnor6.0 Rnor_5.0 14 106,449,633 - 106,450,333 UniSTS Rnor5.0 RGSC_v3.4 14 102,259,426 - 102,260,126 UniSTS RGSC3.4 Celera 14 94,640,863 - 94,641,563 UniSTS Cytogenetic Map 14 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011429 ⟹ ENSRNOP00000011429
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 95,630,306 - 95,645,925 (-) Ensembl Rnor_6.0 Ensembl 14 106,378,942 - 106,393,670 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094321 ⟹ ENSRNOP00000088696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 95,630,306 - 95,640,911 (-) Ensembl
RefSeq Acc Id:
NM_001316877 ⟹ NP_001303806
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 99,831,934 - 99,847,227 (-) NCBI mRatBN7.2 14 95,630,625 - 95,645,920 (-) NCBI Rnor_6.0 14 106,378,349 - 106,393,642 (-) NCBI Celera 14 94,639,971 - 94,655,156 (-) NCBI
Sequence:
CTGTTCCGCTGTAGAGGTGACCTGACTGCTGGAGACTGTCTTTGCTGGTGCAGAGATCGGCCTTGCAGTTTGCAATAATGTCTGAGCCAATCAGAGTCCTCGTGACAGGAGCAGCCGGTCAGATTGCA
hide sequence
RefSeq Acc Id:
NM_033235 ⟹ NP_150238
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 99,831,934 - 99,847,227 (-) NCBI mRatBN7.2 14 95,630,625 - 95,645,920 (-) NCBI Rnor_6.0 14 106,378,349 - 106,393,642 (-) NCBI Rnor_5.0 14 106,449,337 - 106,463,995 (-) NCBI RGSC_v3.4 14 102,259,130 - 102,273,788 (-) RGD Celera 14 94,639,971 - 94,655,156 (-) NCBI
Sequence:
CTGTTCCGCTGTAGAGGTGACCTGACTGCTGGAGACTGTCTTTGCTGGTGCAGAGATCGGCCTTGCAGTTTGCAATAATGTCTGAGCCAATCAGAGTCCTCGTGACAGGAGCAGCCGGTCAGATTGCA
hide sequence
RefSeq Acc Id:
NP_150238 ⟸ NM_033235
- Peptide Label:
isoform Mdh1
- UniProtKB:
O88585 (UniProtKB/Swiss-Prot), Q6PCV2 (UniProtKB/Swiss-Prot), O88989 (UniProtKB/Swiss-Prot), A6JQ40 (UniProtKB/TrEMBL), A0A8I6A721 (UniProtKB/TrEMBL)
- Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIV
hide sequence
RefSeq Acc Id:
NP_001303806 ⟸ NM_001316877
- Peptide Label:
isoform Mdh1x
- UniProtKB:
A0A8I6A721 (UniProtKB/TrEMBL)
- Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIV
hide sequence
Ensembl Acc Id:
ENSRNOP00000011429 ⟸ ENSRNOT00000011429
Ensembl Acc Id:
ENSRNOP00000088696 ⟸ ENSRNOT00000094321
RGD ID: 13699515 Promoter ID: EPDNEW_R10039 Type: initiation region Name: Mdh1_1 Description: malate dehydrogenase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 14 106,393,647 - 106,393,707 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-10
Mdh1
malate dehydrogenase 1
Mdh1
malate dehydrogenase 1, NAD (soluble)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Mdh1
malate dehydrogenase 1, NAD (soluble)
malate dehydrogenase 1
Name updated
1299863 APPROVED
2003-05-19
Mdh1
malate dehydrogenase 1
Mor2
malate dehydrogenase, soluble
Data merged from RGD:619720
629477 PROVISIONAL
2003-04-09
Mdh1
malate dehydrogenase 1
Mdhl
Malate dehydrogenase-like enzyme
Symbol and Name updated
629477 APPROVED
2002-08-07
Mor2
malate dehydrogenase, soluble
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Mdhl
Malate dehydrogenase-like enzyme
Symbol and Name status set to approved
70586 APPROVED
