Advanced Search (OLGA)

Gene: Ina (internexin neuronal intermediate filament protein, alpha) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ina

Name:

internexin neuronal intermediate filament protein, alpha

RGD ID:

2911

Description:

Predicted to be a structural constituent of postsynaptic intermediate filament cytoskeleton. Involved in tissue regeneration. Is active in glutamatergic synapse; postsynaptic density, intracellular component; and postsynaptic intermediate filament cytoskeleton. Orthologous to human INA (internexin neuronal intermediate filament protein alpha); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 2,5-hexanedione; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-internexin; alpha-Inx; Inexa; internexin neuronal intermediate filament protein alpha; internexin, alpha; Intlaa; Nf66

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,838,129 - 255,849,680 (+)	NCBI		GRCr8
mRatBN7.2	1	245,896,775 - 245,908,330 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,896,775 - 245,908,330 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	254,022,799 - 254,034,348 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,716,115 - 260,727,677 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,365,639 - 253,377,183 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,782,835 - 266,794,389 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,781,617 - 266,794,431 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	274,212,015 - 274,224,831 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	252,328,186 - 252,340,997 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,592,442 - 252,605,514 (+)	NCBI
Celera	1	241,668,457 - 241,679,991 (+)	NCBI		Celera
RH 3.4 Map	1	1625.9	RGD
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	Lupus Vasculitis, Central Nervous System	severity	ISO	INA (Homo sapiens)	40886275		RGD
Ina	Rat	middle cerebral artery infarction		ISO	Ina (Mus musculus)	27226878		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	desmoplastic/nodular medulloblastoma		ISO	INA (Homo sapiens)	8554872	ClinVar Annotator: match by term: Desmoplastic/nodular medulloblastoma	ClinVar	PMID:12068298
Ina	Rat	High Myopia		ISO	INA (Homo sapiens)	8554872	ClinVar Annotator: match by term: High myopia	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	amyotrophic lateral sclerosis type 1		ISO	INA (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11796754

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ina (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of INA mRNA	CTD	PMID:22206623
Ina	Rat	1-nitropyrene	increases expression	ISO	INA (Homo sapiens)	6480464	1-nitropyrene results in increased expression of INA mRNA	CTD	PMID:19041380
Ina	Rat	17beta-estradiol	increases expression	ISO	INA (Homo sapiens)	6480464	Estradiol results in increased expression of INA mRNA	CTD	PMID:23019147
Ina	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ina (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of INA mRNA	CTD	PMID:21570461
Ina	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Ina	Rat	2,5-hexanedione	decreases expression	EXP		6480464	2 and 5-hexanedione results in decreased expression of INA protein	CTD	PMID:19033394
Ina	Rat	2-palmitoylglycerol	increases expression	ISO	INA (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of INA mRNA	CTD	PMID:37199045
Ina	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	INA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of INA mRNA	CTD	PMID:28628672
Ina	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of INA mRNA	CTD	PMID:30047161
Ina	Rat	all-trans-retinoic acid	decreases expression	ISO	Ina (Mus musculus)	6480464	Tretinoin results in decreased expression of INA mRNA	CTD	PMID:16604517
Ina	Rat	all-trans-retinoic acid	increases phosphorylation	ISO	INA (Homo sapiens)	6480464	Tretinoin results in increased phosphorylation of INA protein	CTD	PMID:26498558
Ina	Rat	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of INA mRNA	CTD	PMID:24977338
Ina	Rat	all-trans-retinoic acid	decreases expression	ISO	INA (Homo sapiens)	6480464	Tretinoin results in decreased expression of INA mRNA	CTD	PMID:21934132
Ina	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of INA mRNA	CTD	PMID:30047161
Ina	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of INA mRNA	CTD	PMID:16483693
Ina	Rat	ammonium chloride	decreases expression	EXP		6480464	Ammonium Chloride results in decreased expression of INA protein	CTD	PMID:16483693
Ina	Rat	antimycin A	decreases expression	ISO	INA (Homo sapiens)	6480464	Antimycin A results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	arsenite(3-)	increases methylation	ISO	INA (Homo sapiens)	6480464	arsenite results in increased methylation of INA promoter	CTD	PMID:23974009
Ina	Rat	azoxystrobin	decreases expression	ISO	INA (Homo sapiens)	6480464	azoxystrobin results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	benzo[a]pyrene	affects methylation	ISO	INA (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of INA exon	CTD	PMID:27901495
Ina	Rat	benzo[a]pyrene	increases methylation	ISO	INA (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of INA 3' UTR and Benzo(a)pyrene results in increased methylation of INA promoter	CTD	PMID:27901495
Ina	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of INA mRNA	CTD	PMID:25181051 and PMID:30816183
Ina	Rat	bisphenol A	decreases expression	ISO	Ina (Mus musculus)	6480464	bisphenol A results in decreased expression of INA mRNA	CTD	PMID:32156529
Ina	Rat	bisphenol F	multiple interactions	ISO	INA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of INA mRNA	CTD	PMID:28628672
Ina	Rat	Brodifacoum	decreases expression	EXP		6480464	bromfenacoum results in decreased expression of INA protein	CTD	PMID:28903499
Ina	Rat	butanal	increases expression	ISO	INA (Homo sapiens)	6480464	butyraldehyde results in increased expression of INA mRNA	CTD	PMID:26079696
Ina	Rat	camptothecin	increases expression	ISO	INA (Homo sapiens)	6480464	Camptothecin results in increased expression of INA mRNA	CTD	PMID:38460933
Ina	Rat	CGP 52608	multiple interactions	ISO	INA (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to INA gene]	CTD	PMID:28238834
Ina	Rat	chlormequat chloride	decreases expression	EXP		6480464	Chlormequat results in decreased expression of INA protein	CTD	PMID:34958886
Ina	Rat	cisplatin	increases phosphorylation	ISO	Ina (Mus musculus)	6480464	Cisplatin results in increased phosphorylation of INA protein	CTD	PMID:22006019
Ina	Rat	clofibrate	multiple interactions	ISO	Ina (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of INA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of INA mRNA]	CTD	PMID:17585979
Ina	Rat	cocaine	multiple interactions	ISO	Ina (Mus musculus)	6480464	[Cocaine co-treated with FOS protein mutant form] results in increased expression of INA mRNA	CTD	PMID:18355967
Ina	Rat	cocaine	decreases expression	ISO	Ina (Mus musculus)	6480464	Cocaine results in decreased expression of INA mRNA	CTD	PMID:18355967
Ina	Rat	copper atom	multiple interactions	ISO	Ina (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of INA mRNA	CTD	PMID:15467011
Ina	Rat	copper(0)	multiple interactions	ISO	Ina (Mus musculus)	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of INA mRNA	CTD	PMID:15467011
Ina	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of INA mRNA	CTD	PMID:26577399
Ina	Rat	cypermethrin	increases expression	EXP		6480464	cypermethrin results in increased expression of INA protein	CTD	PMID:21561882
Ina	Rat	cypermethrin	multiple interactions	EXP		6480464	Minocycline inhibits the reaction [cypermethrin results in increased expression of INA protein]	CTD	PMID:21561882
Ina	Rat	cytarabine	increases expression	ISO	INA (Homo sapiens)	6480464	Cytarabine results in increased expression of INA mRNA	CTD	PMID:21198554
Ina	Rat	decabromodiphenyl ether	multiple interactions	EXP		6480464	[Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in decreased expression of INA mRNA	CTD	PMID:32207525
Ina	Rat	deguelin	decreases expression	ISO	INA (Homo sapiens)	6480464	deguelin results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	dexamethasone	multiple interactions	ISO	INA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of INA mRNA	CTD	PMID:28628672
Ina	Rat	diallyl trisulfide	increases expression	ISO	INA (Homo sapiens)	6480464	diallyl trisulfide results in increased expression of INA protein	CTD	PMID:19550292
Ina	Rat	enzyme inhibitor	multiple interactions	ISO	INA (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of INA protein	CTD	PMID:23301498
Ina	Rat	ethanol	affects expression	ISO	Ina (Mus musculus)	6480464	Ethanol affects the expression of INA mRNA	CTD	PMID:30319688
Ina	Rat	fenpyroximate	decreases expression	ISO	INA (Homo sapiens)	6480464	fenpyroximate results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of INA mRNA	CTD	PMID:22061828
Ina	Rat	hydrogen peroxide	affects expression	ISO	INA (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of INA protein	CTD	PMID:21179406
Ina	Rat	hydroquinone O-beta-D-glucopyranoside	decreases expression	ISO	INA (Homo sapiens)	6480464	Arbutin results in decreased expression of INA mRNA	CTD	PMID:17103032
Ina	Rat	indometacin	multiple interactions	ISO	INA (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of INA mRNA	CTD	PMID:28628672
Ina	Rat	ivermectin	decreases expression	ISO	INA (Homo sapiens)	6480464	Ivermectin results in decreased expression of INA protein	CTD	PMID:32959892
Ina	Rat	ketamine	increases expression	EXP		6480464	Ketamine results in increased expression of INA protein	CTD	PMID:18504422
Ina	Rat	lipopolysaccharide	decreases expression	ISO	INA (Homo sapiens)	6480464	Lipopolysaccharides results in decreased expression of INA mRNA	CTD	PMID:35811015
Ina	Rat	lipopolysaccharide	multiple interactions	ISO	INA (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of INA mRNA	CTD	PMID:35811015
Ina	Rat	lomustine	multiple interactions	ISO	INA (Homo sapiens)	6480464	INA affects the susceptibility to [Procarbazine co-treated with Lomustine co-treated with Vincristine]	CTD	PMID:21246521
Ina	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of INA mRNA	CTD	PMID:30047161
Ina	Rat	methylisothiazolinone	increases expression	ISO	INA (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of INA mRNA	CTD	PMID:31629900
Ina	Rat	microcystin-LR	increases expression	EXP		6480464	cyanoginosin LR results in increased expression of INA mRNA and cyanoginosin LR results in increased expression of INA protein	CTD	PMID:22430071
Ina	Rat	minocycline	multiple interactions	EXP		6480464	Minocycline inhibits the reaction [cypermethrin results in increased expression of INA protein]	CTD	PMID:21561882
Ina	Rat	N-ethyl-N-nitrosourea	increases expression	EXP		6480464	Ethylnitrosourea results in increased expression of INA mRNA	CTD	PMID:15954086
Ina	Rat	nickel atom	increases expression	ISO	INA (Homo sapiens)	6480464	Nickel results in increased expression of INA mRNA	CTD	PMID:25583101
Ina	Rat	paracetamol	multiple interactions	ISO	Ina (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of INA mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of INA mRNA]	CTD	PMID:17585979
Ina	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of INA mRNA	CTD	PMID:33387578
Ina	Rat	pentanal	increases expression	ISO	INA (Homo sapiens)	6480464	pentanal results in increased expression of INA mRNA	CTD	PMID:26079696
Ina	Rat	picoxystrobin	decreases expression	ISO	INA (Homo sapiens)	6480464	picoxystrobin results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	procarbazine	multiple interactions	ISO	INA (Homo sapiens)	6480464	INA affects the susceptibility to [Procarbazine co-treated with Lomustine co-treated with Vincristine]	CTD	PMID:21246521
Ina	Rat	propanal	increases expression	ISO	INA (Homo sapiens)	6480464	propionaldehyde results in increased expression of INA mRNA	CTD	PMID:26079696
Ina	Rat	pyrimidifen	decreases expression	ISO	INA (Homo sapiens)	6480464	pyrimidifen results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	resveratrol	multiple interactions	ISO	INA (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of INA mRNA	CTD	PMID:23557933
Ina	Rat	rotenone	decreases expression	ISO	INA (Homo sapiens)	6480464	Rotenone results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	INA (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of INA mRNA	CTD	PMID:35811015
Ina	Rat	sarin	decreases expression	EXP		6480464	Sarin results in decreased expression of INA protein	CTD	PMID:28973502
Ina	Rat	SB 431542	multiple interactions	ISO	INA (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of INA protein	CTD	PMID:37664457
Ina	Rat	silicon dioxide	increases expression	ISO	INA (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of INA mRNA and Silicon Dioxide results in increased expression of INA mRNA	CTD	PMID:25351596 and PMID:25895662
Ina	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of INA mRNA	CTD	PMID:19281266
Ina	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of INA mRNA	CTD	PMID:30047161
Ina	Rat	sulforaphane	affects binding	ISO	INA (Homo sapiens)	6480464	INA protein binds to sulforaphane	CTD	PMID:21838287
Ina	Rat	tebufenpyrad	decreases expression	ISO	INA (Homo sapiens)	6480464	4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of INA mRNA	CTD	PMID:33512557
Ina	Rat	thapsigargin	increases expression	ISO	INA (Homo sapiens)	6480464	Thapsigargin results in increased expression of INA mRNA	CTD	PMID:29453283
Ina	Rat	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of INA protein	CTD	PMID:35544339
Ina	Rat	triclosan	decreases expression	ISO	INA (Homo sapiens)	6480464	Triclosan results in decreased expression of INA mRNA	CTD	PMID:30510588
Ina	Rat	triptonide	increases expression	ISO	Ina (Mus musculus)	6480464	triptonide results in increased expression of INA mRNA	CTD	PMID:33045310
Ina	Rat	trovafloxacin	increases expression	ISO	Ina (Mus musculus)	6480464	trovafloxacin results in increased expression of INA mRNA	CTD	PMID:35537566
Ina	Rat	tunicamycin	decreases expression	ISO	INA (Homo sapiens)	6480464	Tunicamycin results in decreased expression of INA mRNA	CTD	PMID:22378314
Ina	Rat	valproic acid	affects expression	ISO	INA (Homo sapiens)	6480464	Valproic Acid affects the expression of INA mRNA	CTD	PMID:25979313 and PMID:26072468
Ina	Rat	valproic acid	affects expression	ISO	Ina (Mus musculus)	6480464	Valproic Acid affects the expression of INA mRNA	CTD	PMID:26072468
Ina	Rat	valproic acid	increases expression	ISO	INA (Homo sapiens)	6480464	Valproic Acid results in increased expression of INA mRNA	CTD	PMID:23179753 more ...
Ina	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of INA mRNA	CTD	PMID:19015723
Ina	Rat	vincristine	multiple interactions	ISO	INA (Homo sapiens)	6480464	INA affects the susceptibility to [Procarbazine co-treated with Lomustine co-treated with Vincristine]	CTD	PMID:21246521
Ina	Rat	vorinostat	decreases expression	ISO	INA (Homo sapiens)	6480464	vorinostat results in decreased expression of INA mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ina	Rat	cellular response to leukemia inhibitory factor	acts_upstream_of_or_within	ISO	Ina (Mus musculus)	1624291	PMID:20439489	RGD	PMID:20439489
Ina	Rat	cellular response to leukemia inhibitory factor	acts_upstream_of_or_within	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	intermediate filament cytoskeleton organization	acts_upstream_of_or_within	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	intermediate filament cytoskeleton organization	acts_upstream_of_or_within	ISO	Ina (Mus musculus)	1624291	PMID:14561875	RGD	PMID:14561875
Ina	Rat	intermediate filament organization	involved_in	IBA	MGI:95697 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ina	Rat	nervous system development	involved_in	IEA	UniProtKB-KW:KW-0524	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ina	Rat	neurofilament cytoskeleton organization	acts_upstream_of_or_within	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	neurofilament cytoskeleton organization	acts_upstream_of_or_within	ISO	Ina (Mus musculus)	1624291	MGI:97313 PMID:10350642	RGD	PMID:10350642
Ina	Rat	postsynaptic intermediate filament cytoskeleton organization	involved_in	IEA	GO:0099184	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Ina	Rat	postsynaptic modulation of chemical synaptic transmission	involved_in	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	postsynaptic modulation of chemical synaptic transmission	involved_in	ISO	Ina (Mus musculus)	1624291	PMID:25869803	RGD	PMID:25869803
Ina	Rat	substantia nigra development	involved_in	ISO	INA (Homo sapiens)	9068941	PMID:22926577	UniProt	PMID:22926577
Ina	Rat	tissue regeneration		IEP		628341		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	cytoplasmic ribonucleoprotein granule	located_in	IEA	UniProtKB:Q16352 and ensembl:ENSP00000358865	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	cytoplasmic ribonucleoprotein granule	located_in	ISO	INA (Homo sapiens)	1624291	PMID:15121898	RGD	PMID:15121898
Ina	Rat	glutamatergic synapse	is_active_in	IDA		13702147	PMID:9310396	SynGO
Ina	Rat	glutamatergic synapse	is_active_in	IEP		13702147	PMID:9310396	SynGO
Ina	Rat	intermediate filament	located_in	IEA	UniProtKB-KW:KW-0403	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ina	Rat	intermediate filament	located_in	IEA	InterPro:IPR006821	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Ina	Rat	intermediate filament	is_active_in	IBA	MGI:95697 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ina	Rat	neurofilament	located_in	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	neurofilament	located_in	ISO	Ina (Mus musculus)	1624291	PMID:10221457	RGD	PMID:10221457
Ina	Rat	postsynapse	is_active_in	IDA		13702147	PMID:9310396	SynGO
Ina	Rat	postsynapse	is_active_in	ISO	Ina (Mus musculus)	1624291	PMID:25869803	RGD	PMID:25869803
Ina	Rat	postsynapse	is_active_in	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	postsynaptic density, intracellular component	is_active_in	IDA		13702147	PMID:9310396	SynGO
Ina	Rat	postsynaptic density, intracellular component	is_active_in	IEP		13702147	PMID:9310396	SynGO
Ina	Rat	postsynaptic intermediate filament cytoskeleton	is_active_in	IDA		13702147	PMID:9310396	SynGO
Ina	Rat	postsynaptic intermediate filament cytoskeleton	is_active_in	IBA	PANTHER:PTN002902039 and Ina (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ina	Rat	postsynaptic intermediate filament cytoskeleton	is_active_in	IEP		13702147	PMID:9310396	SynGO
Ina	Rat	Schaffer collateral - CA1 synapse	is_active_in	ISO	Ina (Mus musculus)	1624291	PMID:25869803	RGD	PMID:25869803
Ina	Rat	Schaffer collateral - CA1 synapse	is_active_in	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ina	Rat	protein binding	enables	ISO	INA (Homo sapiens)	1624291	UniProtKB:O60741 more ...	RGD	PMID:28514442 more ...
Ina	Rat	protein binding	enables	ISO	Ina (Mus musculus)	1624291	PR:P10126 PMID:21689717	RGD	PMID:21689717
Ina	Rat	protein binding	enables	IPI	UniProtKB:Q9EPI6	8554744	PMID:23452857	IntAct
Ina	Rat	protein-containing complex binding		IDA		9743943	heterodimerization	RGD
Ina	Rat	structural constituent of postsynaptic intermediate filament cytoskeleton	enables	IEA	UniProtKB:P46660 and ensembl:ENSMUSP00000041347	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ina	Rat	structural constituent of postsynaptic intermediate filament cytoskeleton	enables	ISO	Ina (Mus musculus)	1624291	PMID:25869803	RGD	PMID:25869803
Ina	Rat	structural constituent of postsynaptic intermediate filament cytoskeleton	enables	IBA	MGI:96568 and PANTHER:PTN002902039	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Heterodimeric associations between neuronal intermediate filament proteins.	Athlan ES and Mushynski WE, J Biol Chem. 1997 Dec 5;272(49):31073-8.
2.	Structure of the gene for the neuronal intermediate filament protein alpha-internexin and functional analysis of its promoter.	Ching GY and Liem RK, J Biol Chem 1991 Oct 15;266(29):19459-68.
3.	The predicted amino acid sequence of alpha-internexin is that of a novel neuronal intermediate filament protein.	Fliegner KH, etal., EMBO J 1990 Mar;9(3):749-55.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Encoding and transducing the synaptic or extrasynaptic origin of NMDA receptor signals to the nucleus.	Karpova A, etal., Cell. 2013 Feb 28;152(5):1119-33. doi: 10.1016/j.cell.2013.02.002.
7.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
8.	Anti-alpha-internexin autoantibody from neuropsychiatric lupus induce cognitive damage via inhibiting axonal elongation and promote neuron apoptosis.	Lu XY, etal., PLoS One. 2010 Jun 15;5(6):e11124. doi: 10.1371/journal.pone.0011124.
9.	Impaired Neurofilament Integrity and Neuronal Morphology in Different Models of Focal Cerebral Ischemia and Human Stroke Tissue.	Mages B, etal., Front Cell Neurosci. 2018 Jun 18;12:161. doi: 10.3389/fncel.2018.00161. eCollection 2018.
10.	Axonally transported peripheral signals regulate alpha-internexin expression in regenerating motoneurons.	McGraw TS, etal., J Neurosci 2002 Jun 15;22(12):4955-63.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.	Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
14.	GOA pipeline	RGD automated data pipeline
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Excitable membranes and synaptic transmission: postsynaptic mechanisms. Localization of alpha-internexin in the postsynaptic density of the rat brain.	Suzuki T, etal., Brain Res. 1997 Aug 8;765(1):74-80.
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

PMID:10221457	PMID:10350642	PMID:14561875	PMID:15121898	PMID:15673434	PMID:15686957	PMID:15880430	PMID:17005864	PMID:17634366	PMID:20124353	PMID:20131911	PMID:20439489
PMID:22664934	PMID:22871113	PMID:22926577	PMID:24625528	PMID:25002582	PMID:25869803	PMID:29476059	PMID:32357304

Ina
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	255,838,129 - 255,849,680 (+)	NCBI		GRCr8
mRatBN7.2	1	245,896,775 - 245,908,330 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	245,896,775 - 245,908,330 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	254,022,799 - 254,034,348 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	260,716,115 - 260,727,677 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	253,365,639 - 253,377,183 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	266,782,835 - 266,794,389 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	266,781,617 - 266,794,431 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	274,212,015 - 274,224,831 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	252,328,186 - 252,340,997 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	252,592,442 - 252,605,514 (+)	NCBI
Celera	1	241,668,457 - 241,679,991 (+)	NCBI		Celera
RH 3.4 Map	1	1625.9	RGD
Cytogenetic Map	1	q54	NCBI

INA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	103,277,138 - 103,290,346 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	103,277,138 - 103,290,346 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	105,036,895 - 105,050,103 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	105,026,910 - 105,040,093 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	105,026,909 - 105,040,091	NCBI
Celera	10	98,776,844 - 98,790,035 (+)	NCBI		Celera
Cytogenetic Map	10	q24.33	NCBI
HuRef	10	98,669,249 - 98,682,440 (+)	NCBI		HuRef
CHM1_1	10	105,321,090 - 105,334,278 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	104,165,761 - 104,178,983 (+)	NCBI		T2T-CHM13v2.0

Ina
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	47,003,120 - 47,013,766 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	47,003,137 - 47,013,766 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	47,014,681 - 47,025,327 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	47,014,698 - 47,025,327 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	47,089,188 - 47,098,848 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	47,068,013 - 47,077,971 (+)	NCBI		MGSCv36	mm8
Celera	19	47,782,907 - 47,792,585 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	39.07	NCBI

Ina
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955485	7,238,723 - 7,266,995 (-)	NCBI	ChiLan1.0	ChiLan1.0

INA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	115,164,226 - 115,177,505 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	115,169,672 - 115,182,837 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	99,877,665 - 99,890,947 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	103,340,438 - 103,353,888 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	103,340,438 - 103,353,888 (+)	Ensembl	panpan1.1		panPan2

INA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	15,670,919 - 15,685,080 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	15,670,999 - 15,683,380 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	15,843,032 - 15,857,216 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	16,146,691 - 16,160,880 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	16,146,376 - 16,160,876 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	15,696,438 - 15,710,613 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	15,728,136 - 15,742,330 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	15,862,624 - 15,876,811 (+)	NCBI		UU_Cfam_GSD_1.0

Ina
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	31,144,424 - 31,157,296 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936600	2,746,772 - 2,760,573 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936600	2,747,649 - 2,760,517 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

INA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	114,227,993 - 114,240,558 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	114,227,998 - 114,240,566 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	124,168,530 - 124,181,111 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

INA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	96,325,122 - 96,338,057 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	96,325,180 - 96,336,358 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	57,437,980 - 57,450,929 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ina
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624831	2,529,725 - 2,540,759 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624831	2,529,710 - 2,541,630 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ina
75 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	135
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000027417
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	238699859	259647894	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	245907761	257976495	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	232156370	259647894	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233190394	258625266	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	38	113	67	65	35	24	35	6	176	83	93	41	60	30


RefSeq Transcripts	NM_019128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M73049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X52017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027417 ⟹ ENSRNOP00000027417

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	245,896,775 - 245,908,330 (+)	Ensembl
Rnor_6.0 Ensembl	1	266,781,617 - 266,794,431 (+)	Ensembl

RefSeq Acc Id:

NM_019128 ⟹ NP_062001

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	255,838,129 - 255,849,680 (+)	NCBI
mRatBN7.2	1	245,896,775 - 245,908,330 (+)	NCBI
Rnor_6.0	1	266,782,835 - 266,794,389 (+)	NCBI
Rnor_5.0	1	274,212,015 - 274,224,831 (+)	NCBI
RGSC_v3.4	1	252,328,186 - 252,340,997 (+)	RGD
Celera	1	241,668,457 - 241,679,991 (+)	NCBI

Sequence:

show sequence

ACCCAGCCTTGCCGCACCTTCGCGTCCTCGCCAGGTCCCGCCGCAGCCGCGCACCCGGCCCCGACCCCGGCACCATGAGCTTCGGATCAGAGCACTACTTGTGCTCCGCCTCCTCCTACCGCAAGGTG
TTCGGGGATGGCTCGCGCCTGTCTGCGCGCCTGTCCGGGCCGGGAGGCTCCGGCAGCTTTCGCTCGCAGTCGCTGTCCCGCAGCAATGTGGCCTCCACGGCCGCTTGCTCCTCGGCCTCGTCTCTCGG
CCTGGGCCTGGCCTACCGCCGCCTGCCGGCCTCCGACGGGCTGGACCTGAGCCAAGCAGCGGCGCGCACCAACGAGTACAAGATCATCCGCACTAACGAGAAGGAGCAGCTGCAGGGCCTCAACGACC
GCTTCGCGGTGTTCATCGAAAAGGTGCACCAGCTGGAGACGCAGAACCGCGCGCTCGAGGCCGAGCTGGCCGCGCTGCGCCAGCGCCACGCCGAGCCGTCGCGCGTCGGCGAGCTCTTCCAGCGCGAG
CTGCGCGAGCTGCGCGCGCAGCTGGAGGAGGCGAGCTCCGCGCGCGCGCAGGCCCTGCTGGAGCGCGACGGGCTGGCCGAGGAGGTGCAGCGACTGCGGGCGCGCTGCGAGGAGGAGAGCCGCGGGCG
CGAAGGCGCGGAGCGCGCCCTGAAGGCGCAGCAGCGCGACGTGGACGGCGCCACTCTGGCCCGCCTGGATCTGGAGAAGAAGGTGGAGTCGCTGCTGGACGAGCTGGCCTTCGTGCGCCAGGTGCACG
ACGAGGAGGTGGCCGAGCTCCTGGCCACGCTGCAGGCGTCTTCGCAAGCCGCCGCCGAGGTGGACGTGGCTGTGGCTAAACCAGACCTGACTTCGGCGCTGAGGGAGATCCGCGCCCAGTATGAGTCC
TTGGCCGCTAAGAACCTGCAGTCGGCCGAGGAGTGGTACAAGTCCAAGTTCGCCAACCTGAACGAGCAGGCTGCGCGCAGCACGGAAGCCATCCGAGCCAGCCGAGAGGAGATCCACGAGTACCGGCG
CCAGCTCCAGGCTCGTACCATTGAGATAGAGGGCCTGCGCGGAGCCAATGAATCCCTGGAGAGGCAGATCTTGGAACTGGAGGAGCGGCACAGCGCTGAGGTGGCCGGCTACCAGGATAGCATTGGGC
AGCTGGAGAGTGACCTGAGGAACACCAAGAGCGAGATGGCCCGCCACCTTCGGGAATACCAGGACTTGCTCAATGTCAAAATGGCTCTTGACATTGAGATAGCAGCTTACAGGAAGCTGCTGGAAGGT
GAAGAGACACGATTTAGCACCAGCGGGTTAAGCATCTCAGGGCTGAATCCACTTCCCAATCCCAGTTATTTGCTCCCTCCTAGAATCCTTAGTTCTACAACCTCCAAAGTCTCATCCGCTGGGCTGTC
CCTGAAAAAGGAGGAGGAGGAGGAGGAGGAGGAAGAGGAAGAAGGGGCTTCTAAGGAAGTCACTAAGAAAACATCCAAGGTAGGGGAAAGTTTCGAAGAAACACTGGAGGAAACGGTGGTATCTACGA
AGAAAACCGAAAAGTCAACTATAGAAGAAATCACCACCAGTTCCAACCAAAAAATGTAATGCTGTTGCTTAAAAAAAAAAACAAAAAAAGGCGATGCCTAAGAGGGAATGCACTTGGCTTATTCACAG
CTTACTCCTGAACCACACCTACCACCGCTATAGAATGTCTTCAAGGCTTCAATGTCATAGTCTGTACCGAATCCTCGCTCTCTCCAGTAGGAAGGCCACTGTAGCTGGGAGCAAACTGCAGTGCTGGA
GGAGGAGCAGGAGGAGCTCTCTAAGATCACAGCTTTCCTACCTACAGCTCAGGCCTCATAGTGACAGGTGACCCAGGTGCAGAGGAGGCTCAAACGAAGGTGCTAAATCTGGTCATCGCTCGCTGTGA
GCTGAAATCGAAACCTGTTTCTCCACCGTACCCCGCCAGTACCCAGCCATAGAACCTCACTGTAGATGTCTAAAAATATACAGTCACTGCCGAGGACAAGCTAGTGCTCCAGACACCATTCTCCCATC
CCCCTCTGATAGAGCTGAGTCACAAAACGACGGTCGTCTCTCATGGGCAGGTTTCCTTCCTCTCTCTTCAATCCCGTATTGCCATTTCTCCCACCTGAGAGGAAGGAACAAAGTTTAGTGTGGTATCC
CCTTCTAGACACGCATAGAACTTACGCCCTTTAGTCCTCCACTCCGTGGGTAAATTAGATGCATGTTGACCATTCCCGTGATTTGTATAACGCACCCTTGTCCATTTCATGACCTTTCATGTCCGTAG
CTTAAAAAATAGAAAGTGATTAATGATAATGGCAGTGATTGGTTTTAAGGGTTTTCCTAAAATAATACTAATTATAATAATAATCATAAAAGGGATCTCTAGACTTTAGGCTTTCAGCTTATCCAGAT
CCACTTAATTAGAGAGGAAAAAAATTACCTTAAATGATGTAGCATTTCACCTTAAATTTAGAGGCACGGTGATAGTTGCCCTACTCTGCGCTTAAGCTGACCTTAGACCTCGTATCGTAAGTAGAGTG
AGTGAGTGAGTGCTCTGAAGGGAAAGAACAAGGTCTCCTCTGTGTTGGTTTCTATGTAGTGCTATAGAATTAGCTTTCTCATACCCTTGCCCTAGGATCTACATAATTCCCTTCCCATTAGGGTAGTA
TGCTATGTATAGGACATTTTATCACCAGACACAACGCTACTGCCCAAAAGTGAAAAACACACACTTCTGGTCAATCAACACCACCAGCAAATATTTAAAAAAAATAAAAAAGGAAAGGAAGAAAGAAA
GAAAGAAAGAAAGAGAGAGAGAGAGAGAAAGAAAGAAAGAGAAAGATTGATTCTCAGAGTCTTTTCCTAACAGGGTTACATTGCTTCAGTTGGTGGATGTCCCTCCCCTGAAGGAAAGACAGAAACAT
TATTCAGGGTCCAGGAGGGGTATGCACACTTCTCCCCCACCTCAAGAAGGCAGGCTGGAAAGTCAGCTCTTCGTGCACTCAACTGTGGCATCCACATGACCTGTCTGCCTCGCGTGCCAAACTTGATG
CAGGGTTTGCCCTGTCTCTGCTCACTCCCACCAAGCTGTAGAACTGTCTGTCCTGTCCCCGCCCACCCCATCCGCAAGCTCTGTGCTGATAAGGACATGATGCTTCTACTGAATTCACATTCTAGCAC
GTGCTTCAATATAGCTCAAGGAACCGGAAAGACACTTCGTTTTTCCTGACCCATCCCCTCTTGACCCCCCCCCCACACTGTAAGACATTAGTAATATTAAGAAATTAAAAGTCATTAATCCTA

hide sequence


Protein RefSeqs	NP_062001	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41444	(Get FASTA)	NCBI Sequence Viewer
	CAA36264	(Get FASTA)	NCBI Sequence Viewer
	EDL94366	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027417
GenBank Protein	P23565	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062001 ⟸ NM_019128

- UniProtKB:

P23565 (UniProtKB/Swiss-Prot), G3V8Q2 (UniProtKB/TrEMBL), A6JHP2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSFGSEHYLCSASSYRKVFGDGSRLSARLSGPGGSGSFRSQSLSRSNVASTAACSSASSLGLGLAYRRLPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAA
LRQRHAEPSRVGELFQRELRELRAQLEEASSARAQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVAV
AKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLESDLRNTKSEMARHLREYQDLLN
VKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSSTTSKVSSAGLSLKKEEEEEEEEEEEGASKEVTKKTSKVGESFEETLEETVVSTKKTEKSTIEEITTSSNQKM

hide sequence

Ensembl Acc Id:

ENSRNOP00000027417 ⟸ ENSRNOT00000027417

Protein Domains

IF rod

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P23565-F1-model_v2	AlphaFold	P23565	1-505	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-55494	BioCyc
Ensembl Genes	ENSRNOG00000020248	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000027417	ENTREZGENE
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
	Single helix bin	UniProtKB/Swiss-Prot
	Vasodilator-stimulated phosphoprotein	UniProtKB/Swiss-Prot
InterPro	IF_conserved	UniProtKB/Swiss-Prot
	IF_rod_dom	UniProtKB/Swiss-Prot
	Intermed_filament_DNA-bd	UniProtKB/Swiss-Prot
	Intermediate_filament	UniProtKB/Swiss-Prot
NCBI Gene	24503	ENTREZGENE
PANTHER	GLIAL FIBRILLARY ACIDIC PROTEIN	UniProtKB/Swiss-Prot
	PTHR45652:SF18	UniProtKB/Swiss-Prot
Pfam	Filament	UniProtKB/Swiss-Prot
	Filament_head	UniProtKB/Swiss-Prot
PhenoGen	Ina	PhenoGen
PROSITE	IF_ROD_1	UniProtKB/Swiss-Prot
	IF_ROD_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020248	RatGTEx
SMART	Filament	UniProtKB/Swiss-Prot
Superfamily-SCOP	Intermediate filament protein, coiled coil region	UniProtKB/Swiss-Prot
	Myosin rod fragments	UniProtKB/Swiss-Prot
TIGR	TC233138
UniProt	A6JHP2	ENTREZGENE, UniProtKB/TrEMBL
	AINX_RAT	UniProtKB/Swiss-Prot
	G3V8Q2	ENTREZGENE, UniProtKB/TrEMBL
	P23565	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-14	Ina	internexin neuronal intermediate filament protein, alpha	Inexa	internexin, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Inexa	internexin, alpha			Symbol and Name status set to approved	70586	APPROVED

Note Type	Note	Reference
gene_expression	found predominantly in adult CNS	625364
gene_expression	mRNA level decreases as development progresses	628341
gene_expression	mRNA noticed in uninjured facial neurons	628341
gene_function	self-assembling class-iv neuronal intermediate filament	69861
gene_function	self-assembling class-iv neuronal intermediate filament	625364
gene_process	first neurofilament which is expressed during development	628341
gene_process	may mediate neuronal regeneration	628341
gene_process	involved in morphogenesis of neurons	69861
gene_process	involved in morphogenesis of neurons	625364
gene_product	64-66 kDa protein	628341
gene_regulation	expression is dependent on the rate of muscle reinnervation	628341

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD