Crybb1 (crystallin, beta B1) - Rat Genome Database

Name: Crybb1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Crybb1 (crystallin, beta B1) Rattus norvegicus

Analyze

Symbol:

Crybb1

Name:

crystallin, beta B1

RGD ID:

2416

Description:

A structural constituent of eye lens. Predicted to be involved in lens development in camera-type eye and visual perception. Human ortholog(s) of this gene implicated in cataract and cataract 17 multiple types. Orthologous to human CRYBB1 (crystallin beta B1); INTERACTS WITH acrylamide; bisphenol A; C60 fullerene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

beta-B1 crystallin; beta-crystallin B1; CRYB1; CRYB11; crystallin beta B1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CRYBB1 (crystallin beta B1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Crybb1 (crystallin, beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Crybb1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CRYBB1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CRYBB1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Crybb1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CRYBB1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CRYBB1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Crybb1 (crystallin beta B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRYBB3 (crystallin beta B3)	HGNC	OrthoDB
Homo sapiens (human):	CRYBB2 (crystallin beta B2)	HGNC	OrthoDB
Homo sapiens (human):	PHKG1 (phosphorylase kinase catalytic subunit gamma 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Crybb1 (crystallin, beta B1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CRYBB1 (crystallin beta B1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	crybb1 (crystallin, beta B1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	crybb1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	50,030,146 - 50,043,756 (-)	NCBI		GRCr8
mRatBN7.2	12	44,369,734 - 44,383,344 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	44,369,735 - 44,383,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	45,538,591 - 45,552,345 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	46,149,005 - 46,162,615 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	45,209,536 - 45,223,146 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	50,390,939 - 50,404,550 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	50,390,940 - 50,404,550 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	52,147,268 - 52,160,879 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	45,952,784 - 45,966,534 (-)	NCBI		Celera
RH 3.4 Map	12	776.72	RGD
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract (ISO)

cataract 17 multiple types (ISO)

cataract 23 (ISO)

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphotericin B (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

C60 fullerene (EXP)

carmustine (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

Cuprizon (EXP)

ethylparaben (ISO)

flavonoids (EXP)

mono(2-ethylhexyl) phthalate (ISO)

niclosamide (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

sodium dichromate (EXP)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

lens development in camera-type eye (IBA)

visual perception (IBA)

Molecular Function

protein binding (ISO)

structural constituent of eye lens (IBA,IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat lens beta-crystallins are internally duplicated and homologous to gamma-crystallins.	den Dunnen JT, etal., Biochim Biophys Acta 1985 Apr 19;824(4):295-303.
2.	Intron insertions and deletions in the beta/gamma-crystallin gene family: the rat beta B1 gene.	den Dunnen JT, etal., Proc Natl Acad Sci U S A 1986 May;83(9):2855-9.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Lens proteomics: analysis of rat crystallin sequences and two-dimensional electrophoresis map.	Lampi KJ, etal., Invest Ophthalmol Vis Sci 2002 Jan;43(1):216-24.
7.	A nonsense mutation in CRYBB1 associated with autosomal dominant cataract linked to human chromosome 22q.	Mackay DS, etal., Am J Hum Genet 2002 Nov;71(5):1216-21.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8405363	PMID:12477932

Genomics

Comparative Map Data

Crybb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	50,030,146 - 50,043,756 (-)	NCBI		GRCr8
mRatBN7.2	12	44,369,734 - 44,383,344 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	44,369,735 - 44,383,344 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	45,538,591 - 45,552,345 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	46,149,005 - 46,162,615 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	45,209,536 - 45,223,146 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	50,390,939 - 50,404,550 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	50,390,940 - 50,404,550 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	52,147,268 - 52,160,879 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	45,952,784 - 45,966,534 (-)	NCBI		Celera
RH 3.4 Map	12	776.72	RGD
Cytogenetic Map	12	q16	NCBI

CRYBB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	26,599,278 - 26,618,027 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	26,599,278 - 26,618,027 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	26,995,242 - 27,013,991 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	25,325,362 - 25,343,991 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	25,319,915 - 25,338,545	NCBI
Celera	22	10,799,161 - 10,817,792 (-)	NCBI		Celera
Cytogenetic Map	22	q12.1	ENTREZGENE
HuRef	22	9,942,881 - 9,961,511 (-)	NCBI		HuRef
CHM1_1	22	26,954,881 - 26,973,527 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	27,061,628 - 27,080,697 (-)	NCBI		T2T-CHM13v2.0

Crybb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	112,403,686 - 112,417,451 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	112,403,681 - 112,417,451 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	112,254,563 - 112,269,585 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	112,255,815 - 112,269,585 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	112,684,841 - 112,698,602 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	112,496,124 - 112,509,885 (+)	NCBI		MGSCv36	mm8
Celera	5	109,375,405 - 109,389,151 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	54.63	NCBI

Crybb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	1,165,048 - 1,180,826 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	1,165,048 - 1,180,826 (-)	NCBI	ChiLan1.0	ChiLan1.0

CRYBB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	36,604,824 - 36,623,396 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	39,303,287 - 39,321,857 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	7,661,085 - 7,679,640 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	25,383,681 - 25,402,158 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	25,383,681 - 25,402,158 (-)	Ensembl	panpan1.1		panPan2

CRYBB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	20,258,873 - 20,269,647 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	20,258,877 - 20,287,217 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	20,122,587 - 20,133,372 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	20,622,023 - 20,632,822 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	20,622,027 - 20,650,377 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	20,343,574 - 20,354,371 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	20,594,199 - 20,605,216 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	20,664,547 - 20,675,365 (-)	NCBI		UU_Cfam_GSD_1.0

Crybb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	114,660,332 - 114,676,677 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936657	1,193,474 - 1,210,443 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936657	1,194,030 - 1,210,345 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CRYBB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	44,194,199 - 44,208,154 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	44,194,268 - 44,206,057 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	47,074,156 - 47,085,979 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CRYBB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	9,500,341 - 9,517,178 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	9,500,431 - 9,515,068 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	116,585,561 - 116,602,261 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Crybb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	3,125,168 - 3,137,576 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	3,125,168 - 3,137,576 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Crybb1
62 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	124
Count of miRNA genes:	94
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000071613, ENSRNOT00000073072
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

RH94677

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	44,369,748 - 44,370,007 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	50,390,954 - 50,391,212	NCBI	Rnor6.0
Rnor_5.0	12	52,147,283 - 52,147,541	UniSTS	Rnor5.0
Celera	12	45,952,799 - 45,953,057	UniSTS
RH 3.4 Map	12	776.72	UniSTS

GDB:362766

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	44,369,820 - 44,370,003 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	50,391,026 - 50,391,208	NCBI	Rnor6.0
Rnor_5.0	12	52,147,355 - 52,147,537	UniSTS	Rnor5.0
Celera	12	45,952,871 - 45,953,053	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		4
Low	2	25	6		2			1	43		21
Below cutoff		4	10	2	6	2	7	9	23	22	13	9	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012936	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF286652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH002154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW919139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC126096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X05900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X06377	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000071613 ⟹ ENSRNOP00000064652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	12	50,391,083 - 50,400,765 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000073072 ⟹ ENSRNOP00000064741

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	44,369,735 - 44,383,344 (-)	Ensembl
Rnor_6.0 Ensembl	12	50,390,940 - 50,404,550 (-)	Ensembl

RefSeq Acc Id:

NM_012936 ⟹ NP_037068

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	50,030,146 - 50,043,756 (-)	NCBI
mRatBN7.2	12	44,369,734 - 44,383,344 (-)	NCBI
Rnor_6.0	12	50,390,939 - 50,404,550 (-)	NCBI
Rnor_5.0	12	52,147,268 - 52,160,879 (-)	NCBI
Celera	12	45,952,784 - 45,966,534 (-)	RGD

Sequence:

show sequence

GCGGGCCCCATCCAGGTTTGCTGAGCCAGCTGCCTCTTTGTGCTACACTATAGACCCTGGTGCC
TGCCAGGTTATAAAATGGGGGGTTGGCCCTGAGGGACCCATAACACCAGCCTGTCCACCAACAC
AGCATCAGAAACCATGTCTCAGGTTGCCAAGGCTGCAGCCACCACTGCGGTGAACCCAGGGCCT
GATGGCAAAGGGAAGGGAACCCCATCCACAGGGACAGCCCCAGCCCCTGGCCCTACTCCTGTCC
CAGCTTCTGTGCCCAGGCCTGCTGCCAAAGTAGGGGAACTGCCTCCTGGAAGCTACAGGCTGGT
CGTCTTTGAGCAGGAAAACTTCCAGGGCCGCCGGGTGGAATTCTCGGGGGAGTGCCTGAACCTG
GGGGACCGTGGCTTCGACAGAGTGCGCAGTCTGATCGTCCTCTCCGGACCCTGGGTGGCCTTTG
AGCAATCTGCCTTCCGTGGGGAGATGTTTGTCCTGGAGAAGGGTGAGTACCCACGATGGGACAC
CTGGACCAGCAGTTACCGCAGTGACCGGCTCATGTCCTTCCGGCCCATCAGGATGGATTCCCAG
GAGCATAAGATCTGCCTGTTTGAAGGGGCCAACTTCAAGGGCAACACCATGGAGATCCAAGAGG
ATGACGTGCCCAGCCTCTGGGTTTATGGCTTCTGTGACCGTGTGGGCAGTATAACCGTCTCCAG
TGGCACATGGGTCGGCTATCAGTACCCAGGCTACCGTGGCTACCAGTATCTGCTGGAGCCCGGA
GACTTCCGGCACTGGAACGAGTGGGGTGCCTTCCAGCCGCAGATGCAGGCTGTGCGGCGCTTGC
GGGACCGTCAGTGGCACCAAGAGGGCTGCTTCCCGGTGCTAACCGCTGAGCCCCCCAAGTGAGC
CAAACTCCTGGCCTCACTTCTACAGCCCGCCCTGCCTCAGGTCCCATCCCCCCTCCCAGTCCCC
TAATAAAGTTCCTACAGCCGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037068	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40979	(Get FASTA)	NCBI Sequence Viewer
	AAF97950	(Get FASTA)	NCBI Sequence Viewer
	AAI26097	(Get FASTA)	NCBI Sequence Viewer
	CAA29329	(Get FASTA)	NCBI Sequence Viewer
	CAA29679	(Get FASTA)	NCBI Sequence Viewer
	EDM14005	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064741
	ENSRNOP00000064741.1
	ENSRNOP00055002593
	ENSRNOP00065006501
GenBank Protein	P02523	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037068 ⟸ NM_012936

- UniProtKB:

A0JN26 (UniProtKB/Swiss-Prot), Q9JHV9 (UniProtKB/Swiss-Prot), P02523 (UniProtKB/Swiss-Prot), A6J266 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSQVAKAAATTAVNPGPDGKGKGTPSTGTAPAPGPTPVPASVPRPAAKVGELPPGSYRLVVFEQ
ENFQGRRVEFSGECLNLGDRGFDRVRSLIVLSGPWVAFEQSAFRGEMFVLEKGEYPRWDTWTSS
YRSDRLMSFRPIRMDSQEHKICLFEGANFKGNTMEIQEDDVPSLWVYGFCDRVGSITVSSGTWV
GYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQAVRRLRDRQWHQEGCFPVLTAEPPK

hide sequence

RefSeq Acc Id:

ENSRNOP00000064741 ⟸ ENSRNOT00000073072

RefSeq Acc Id:

ENSRNOP00000064652 ⟸ ENSRNOT00000071613

Protein Domains

Beta/gamma crystallin 'Greek key'

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02523-F1-model_v2	AlphaFold	P02523	1-250	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2416	AgrOrtholog
BioCyc Gene	G2FUF-18864	BioCyc
Ensembl Genes	ENSRNOG00000047653	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055002197	UniProtKB/Swiss-Prot
	ENSRNOG00065006027	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000073072	ENTREZGENE
	ENSRNOT00000073072.3	UniProtKB/Swiss-Prot
	ENSRNOT00055003484	UniProtKB/Swiss-Prot
	ENSRNOT00065009112	UniProtKB/Swiss-Prot
Gene3D-CATH	Crystallins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8364407	IMAGE-MGC_LOAD
InterPro	Beta/gamma_crystallin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_crystallin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25421	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:156675	IMAGE-MGC_LOAD
NCBI Gene	25421	ENTREZGENE
PANTHER	BETA-CRYSTALLIN B1	UniProtKB/TrEMBL
	BETA/GAMMA CRYSTALLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11818:SF12	UniProtKB/Swiss-Prot
Pfam	Crystall	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Crybb1	PhenoGen
PRINTS	BGCRYSTALLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CRYSTALLIN_BETA_GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000047653	RatGTEx
	ENSRNOG00055002197	RatGTEx
	ENSRNOG00065006027	RatGTEx
SMART	XTALbg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	gamma-Crystallin-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A0JN26	ENTREZGENE
	A6J266	ENTREZGENE, UniProtKB/TrEMBL
	CRBB1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9JHV9	ENTREZGENE
UniProt Secondary	A0JN26	UniProtKB/Swiss-Prot
	Q9JHV9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Crybb1	crystallin, beta B1		crystallin beta B1	Name updated	1299863	APPROVED
2002-06-10	Crybb1	crystallin beta B1			Name updated	70584	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM