Advanced Search (OLGA)

Gene: Cpa3 (carboxypeptidase A3) Rattus norvegicus

Analyze

Symbol:

Cpa3

Name:

carboxypeptidase A3

RGD ID:

2390

Description:

Predicted to enable metallocarboxypeptidase activity. Predicted to be involved in angiotensin maturation. Predicted to act upstream of or within regulation of angiotensin levels in blood. Predicted to be located in transport vesicle. Predicted to be active in extracellular space. Orthologous to human CPA3 (carboxypeptidase A3); PARTICIPATES IN renin-angiotensin cascade pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

carboxypeptidase A3 mast cell; carboxypeptidase A3, mast cell; mast cell carboxypeptidase A; R-CPA; RMC-CP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPA3 (carboxypeptidase A3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cpa3 (carboxypeptidase A3, mast cell)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpa3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPA3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPA3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpa3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPA3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPA3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpa3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cpa3 (carboxypeptidase A3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CPB1 (carboxypeptidase B1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CPA3 (carboxypeptidase A3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpa3 (carboxypeptidase A3, mast cell)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpb1 (carboxypeptidase B1 (tissue))	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG12374	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4408	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG7025	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7025	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8563	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	CG8563	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	ECM14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ECM14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T06A4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)
Caenorhabditis elegans (roundworm):	T06A4.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18585	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18585	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3108	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4017	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4017	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F02D8.4	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG14820	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14820	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17633	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17633	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG2915	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3097	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG18417	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Drosophila melanogaster (fruit fly):	CG18417	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG32379	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA)
Drosophila melanogaster (fruit fly):	CG32379	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8560	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8562	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	W01A8.6	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ZC434.9	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	suro-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42264	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cpa3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cpa3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8539	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG8539	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	LOC105947369	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	104,641,619 - 104,673,253 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	104,641,621 - 104,673,237 (-)	Ensembl				GRCr8
mRatBN7.2	2	102,712,483 - 102,744,219 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	102,712,589 - 102,744,203 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	109,232,601 - 109,264,222 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	107,353,762 - 107,385,392 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	102,306,747 - 102,338,386 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	105,016,798 - 105,047,989 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	105,016,626 - 105,047,984 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	124,745,511 - 124,777,636 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	105,368,835 - 105,402,657 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	98,081,042 - 98,112,943 (-)	NCBI		Celera
RGSC_v3.1	2	105,313,798 - 105,347,605 (-)	NCBI
RH 3.4 Map	2	729.9	RGD
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

calcitriol (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

Cuprizon (EXP)

Dibutyl phosphate (ISO)

elemental selenium (ISO)

endosulfan (ISO)

fenvalerate (EXP)

flavonoids (EXP)

fulvestrant (ISO)

furan (EXP)

genistein (EXP,ISO)

hexachlorobenzene (EXP)

naphthalenes (EXP)

ozone (ISO)

paracetamol (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

rotenone (EXP)

selenium atom (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

tetradecane (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

undecane (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiotensin maturation (ISO)

proteolysis (IBA,IEA)

regulation of angiotensin levels in blood (ISO)

Cellular Component

cytoplasmic vesicle (IEA)

extracellular region (ISO)

extracellular space (IBA)

transport vesicle (IEA)

Molecular Function

carboxypeptidase activity (IEA)

hydrolase activity (IEA)

metal ion binding (IEA)

metallocarboxypeptidase activity (IBA,IEA,ISO)

metallopeptidase activity (IEA)

peptidase activity (IEA,ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

renin-angiotensin cascade pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	The novel imprinted carboxypeptidase A4 gene ( CPA4) in the 7q32 imprinting domain.	Kayashima T, etal., Hum Genet 2003 Mar;112(3):220-6. Epub 2003 Jan 28.
4.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
5.	Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations.	Lutzelschwab C, etal., J Exp Med 1997 Jan 6;185(1):13-29.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1988052	PMID:2708524	PMID:15173164	PMID:23624557	PMID:24953986	PMID:27068509	PMID:27559042

Genomics

Comparative Map Data

Cpa3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	104,641,619 - 104,673,253 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	104,641,621 - 104,673,237 (-)	Ensembl				GRCr8
mRatBN7.2	2	102,712,483 - 102,744,219 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	102,712,589 - 102,744,203 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	109,232,601 - 109,264,222 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	107,353,762 - 107,385,392 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	102,306,747 - 102,338,386 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	105,016,798 - 105,047,989 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	105,016,626 - 105,047,984 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	124,745,511 - 124,777,636 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	105,368,835 - 105,402,657 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	98,081,042 - 98,112,943 (-)	NCBI		Celera
RGSC_v3.1	2	105,313,798 - 105,347,605 (-)	NCBI
RH 3.4 Map	2	729.9	RGD
Cytogenetic Map	2	q24	NCBI

CPA3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	148,865,296 - 148,897,203 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	148,865,296 - 148,897,203 (+)	Ensembl			hg38	GRCh38
GRCh37	3	148,583,083 - 148,614,990 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	150,065,774 - 150,097,552 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	150,065,781 - 150,097,560	NCBI
Celera	3	146,993,118 - 147,024,950 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI
HuRef	3	145,955,149 - 145,986,993 (+)	NCBI		HuRef
CHM1_1	3	148,545,876 - 148,577,717 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	151,616,046 - 151,647,965 (+)	NCBI		T2T-CHM13v2.0

Cpa3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	20,269,780 - 20,296,373 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	20,269,784 - 20,296,345 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	20,215,616 - 20,242,209 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	20,215,620 - 20,242,181 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	20,115,515 - 20,142,080 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	20,407,673 - 20,434,227 (-)	NCBI		MGSCv36	mm8
Celera	3	20,204,832 - 20,231,395 (-)	NCBI		Celera
Cytogenetic Map	3	A2	NCBI
cM Map	3	6.25	NCBI

Cpa3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955474	8,602,958 - 8,626,436 (-)	Ensembl
ChiLan1.0	NW_004955474	8,602,958 - 8,626,436 (-)	NCBI	ChiLan1.0	ChiLan1.0

CPA3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	146,760,053 - 146,793,151 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	146,764,783 - 146,797,881 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	145,889,140 - 145,921,462 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	153,468,252 - 153,500,113 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	153,468,071 - 153,500,333 (+)	Ensembl			panPan2	panpan1.1

CPA3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	43,718,987 - 43,748,335 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	43,679,361 - 43,748,213 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	43,583,372 - 43,612,478 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	44,346,568 - 44,375,767 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	44,276,898 - 44,375,642 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	43,928,939 - 43,958,267 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	43,983,539 - 44,012,801 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	44,237,426 - 44,266,751 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cpa3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	83,015,494 - 83,041,913 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	6,692,513 - 6,718,425 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	6,692,466 - 6,718,480 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPA3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	89,093,296 - 89,132,088 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	97,084,980 - 97,127,970 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPA3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	41,807,728 - 41,839,889 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	41,807,727 - 41,839,819 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	14,650,383 - 14,682,474 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpa3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	26,098,373 - 26,124,104 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	26,098,309 - 26,124,203 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cpa3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	133,896,600 - 133,923,010 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cpa3
371 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	31
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000014970
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	40306867	124537199	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat

Markers in Region

RH94836

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	102,712,656 - 102,712,761 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	105,016,868 - 105,016,972	NCBI	Rnor6.0
Rnor_5.0	2	124,745,581 - 124,745,685	UniSTS	Rnor5.0
RGSC_v3.4	2	105,368,905 - 105,369,009	UniSTS	RGSC3.4
Celera	2	98,081,112 - 98,081,216	UniSTS
RH 3.4 Map	2	729.9	UniSTS
Cytogenetic Map	2	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
13	12	53	98	87	86	55	75	55	6	295	161	11	77	58	74	31	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM101110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U67914	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014970 ⟹ ENSRNOP00000014970

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	104,641,621 - 104,673,237 (-)	Ensembl
mRatBN7.2 Ensembl	2	102,712,589 - 102,744,203 (-)	Ensembl
Rnor_6.0 Ensembl	2	105,016,626 - 105,047,984 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100012 ⟹ ENSRNOP00000095188

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	104,641,621 - 104,673,237 (-)	Ensembl
mRatBN7.2 Ensembl	2	102,712,589 - 102,744,203 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000136092 ⟹ ENSRNOP00000102216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	104,641,621 - 104,673,237 (-)	Ensembl

RefSeq Acc Id:

NM_019300 ⟹ NP_062173

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	104,641,619 - 104,673,237 (-)	NCBI
mRatBN7.2	2	102,712,587 - 102,744,203 (-)	NCBI
Rnor_6.0	2	105,016,798 - 105,047,989 (-)	NCBI
Rnor_5.0	2	124,745,511 - 124,777,636 (-)	NCBI
RGSC_v3.4	2	105,368,835 - 105,402,657 (-)	RGD
Celera	2	98,081,042 - 98,112,943 (-)	RGD

Sequence:

show sequence

CATGAGGTCCTTCTTGCTTATGGGGGTCATCTATTCCACACTTGCAATTGCTCCTGTTCAGTTT
GACAGGGAGAAGGTATTCCGTGTGAAACTCCAGGATGAAAAGCAAGCAAGTATCTTGAAGAACT
TGACCCAAACCATTGAGCTTGACTTCTGGTATCCAGATGCTATCCATGATATTGCTGTTAATAT
GACTGTGGATTTCCGAGTTACTGAGAAGGAATCTCAGACTATCCAGTCTACCTTGGAACAACAT
AAAATGGACTATGAAATTCTGATAAATGACCTACAAGAAGAGATAGACAAACAGTTTGATGTGA
AAGAGGAAATCGCAGGCAGGCACAGTTATGCAAAATACAATGACTGGAACAAGATTGTTTCTTG
GACTGAAAAAATGGTAGAAAAACATCCTGAAATGGTTTCAAGGATTAAAATTGGATCAACTGTT
GAAGATAATCCATTATATGTTCTCAAGATTGGGAGAAAAGATGGAGAAAGAAAGGCTATCTTTA
TGGACTGTGGCATCCATGCTCGTGAATGGGTTTCCCCAGCTTTCTGTCAGTGGTTTGTCTATCA
GGCAGCCAAGAGTTATGGAAAAAATAAAATCATGACCAAACTTTTGGACCGGATGAATTTTTAT
GTTCTGCCCGTATTCAATGTAGATGGATACATTTGGTCATGGACAAAGGATCGAATGTGGAGAA
AAAACCGTTCCAAGAACCCAAATTCAACCTGCATTGGCACTGACCTCAACAGGAACTTCGATGT
CTCATGGGACTCTTCCCCAAACACCGACAACCCATGCCTCAGTGTCTACAGGGGACCTGCACCA
GAGTCCGAGAAAGAGACAAAAGCTGTCACTAACTTCATTCGAAGTCATCTGAACTCAATCAAGG
CTTATATCACCTTCCATTCCTACTCTCAGATGCTGTTATTTCCTTATGGCTACACAATCAAACT
GCCACCCAACCACCAGGACCTGCTGAAGGTTGCGAGGATTGCCACTGATGTTCTCTCAAGTAGA
TATGAAACCCGTTATATCTACGGCCCAATAGCATCCACAATTTACAAGACATCAGGTTCTTCTT
TAGACTGGGCTTATGACCTGGGCATCAAACACACATTTGCCTTTGAGCTTCGTGATAAAGGAAA
ATCTGGTTTCCTTCTTCCAGAATCTCGGATAAAGCCAACATGTAAAGAAACCATGCTTTCTGTC
AAATTTATTGCCAAGTATATCCTCAAGCATACTTCCTAATAAGTTGCCCTTGGTTTGAAATGTG
CTAATTAATCCTTGGGTGGAGCCTTTCCCTGGAAAGACAACCTTCTGCATCACCTGGATCCATC
CTGCTCTTATTCATGAAGTCCTGCATTATTTTCTACTTATTCTTATTTACACCCAATAGCCCCA
CAACAATAAAGCTTTAAGTAAATCCAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102980 ⟹ XP_038958908

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	104,641,619 - 104,673,253 (-)	NCBI
mRatBN7.2	2	102,712,483 - 102,744,219 (-)	NCBI

RefSeq Acc Id:

XM_039102981 ⟹ XP_038958909

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	104,641,619 - 104,673,253 (-)	NCBI
mRatBN7.2	2	102,712,788 - 102,744,219 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062173	(Get FASTA)	NCBI Sequence Viewer
	XP_038958908	(Get FASTA)	NCBI Sequence Viewer
	XP_038958909	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB48267	(Get FASTA)	NCBI Sequence Viewer
	EDM01080	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014970
	ENSRNOP00000095188
GenBank Protein	P21961	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062173 ⟸ NM_019300
- Peptide Label:	precursor
- UniProtKB:	P97597 (UniProtKB/Swiss-Prot), P21961 (UniProtKB/Swiss-Prot), F1M7S4 (UniProtKB/TrEMBL), A6IHD2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRSFLLMGVIYSTLAIAPVQFDREKVFRVKLQDEKQASILKNLTQTIELDFWYPDAIHDIAVNM TVDFRVTEKESQTIQSTLEQHKMDYEILINDLQEEIDKQFDVKEEIAGRHSYAKYNDWNKIVSW TEKMVEKHPEMVSRIKIGSTVEDNPLYVLKIGRKDGERKAIFMDCGIHAREWVSPAFCQWFVYQ AAKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTKDRMWRKNRSKNPNSTCIGTDLNRNFDV SWDSSPNTDNPCLSVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLFPYGYTIKL PPNHQDLLKVARIATDVLSSRYETRYIYGPIASTIYKTSGSSLDWAYDLGIKHTFAFELRDKGK SGFLLPESRIKPTCKETMLSVKFIAKYILKHTS hide sequence

Ensembl Acc Id:

ENSRNOP00000014970 ⟸ ENSRNOT00000014970

RefSeq Acc Id:	XP_038958908 ⟸ XM_039102980
- Peptide Label:	isoform X1
- UniProtKB:	P97597 (UniProtKB/Swiss-Prot), P21961 (UniProtKB/Swiss-Prot), A0A8I6GL18 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958909 ⟸ XM_039102981
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000095188 ⟸ ENSRNOT00000100012

Ensembl Acc Id:

ENSRNOP00000102216 ⟸ ENSRNOT00000136092

Protein Domains

Peptidase M14

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21961-F1-model_v2	AlphaFold	P21961	1-412	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691259

Promoter ID:

EPDNEW_R1784

Type:

single initiation site

Name:

Cpa3_1

Description:

carboxypeptidase A3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	105,047,999 - 105,048,059	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2390	AgrOrtholog
BioCyc Gene	G2FUF-53603	BioCyc
Ensembl Genes	ENSRNOG00000011181	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014970	ENTREZGENE
	ENSRNOT00000100012	ENTREZGENE
Gene3D-CATH	3.30.70.340	UniProtKB/Swiss-Prot
	Zn peptidases	UniProtKB/Swiss-Prot
InterPro	M14A-like_propep	UniProtKB/Swiss-Prot
	M14A_act_pep	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
KEGG Report	rno:54242	UniProtKB/Swiss-Prot
NCBI Gene	54242	ENTREZGENE
PANTHER	MAST CELL CARBOXYPEPTIDASE A	UniProtKB/Swiss-Prot
	PROTEASE FAMILY M14 CARBOXYPEPTIDASE A,B	UniProtKB/Swiss-Prot
Pfam	Peptidase_M14	UniProtKB/Swiss-Prot
	Propep_M14	UniProtKB/Swiss-Prot
PhenoGen	Cpa3	PhenoGen
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot
	PEPTIDASE_M14	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011181	RatGTEx
SMART	Zn_pept	UniProtKB/Swiss-Prot
Superfamily-SCOP	Protease propeptides/inhibitors	UniProtKB/Swiss-Prot
	Zn-dependent exopeptidases	UniProtKB/Swiss-Prot
UniProt	A0A8I6GL18	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LBS0_RAT	UniProtKB/TrEMBL
	A6IHD2	ENTREZGENE, UniProtKB/TrEMBL
	CBPA3_RAT	UniProtKB/Swiss-Prot
	F1M7S4	ENTREZGENE, UniProtKB/TrEMBL
	P21961	ENTREZGENE
	P97597	ENTREZGENE
UniProt Secondary	P97597	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-23	Cpa3	carboxypeptidase A3	Cpa3	carboxypeptidase A3, mast cell	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Cpa3	carboxypeptidase A3, mast cell	Cpa3	carboxypeptidase A3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Cpa3	carboxypeptidase A3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in mast cells	69811
gene_product	mast cell protease	69811

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)