Symbol:
Cebpg
Name:
CCAAT/enhancer binding protein gamma
RGD ID:
2330
Description:
Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity, bending. Involved in liver development and regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Orthologous to human CEBPG (CCAAT enhancer binding protein gamma); PARTICIPATES IN tuberculosis pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
C/EBP; c/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer binding protein ,gamma; CCAAT/enhancer-binding protein gamma; CEBPRNA; homolog to a human CCAAT/enhancer binding protein - gamma; rat homolog to a human CCAAT/enhancer binding protein - gamma
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CEBPG (CCAAT enhancer binding protein gamma)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cebpg (CCAAT/enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cebpg (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CEBPG (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CEBPG (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cebpg (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CEBPG (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CEBPG (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cebpg (CCAAT enhancer binding protein gamma)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
KIAA0753 (KIAA0753)
HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Cebpg (CCAAT/enhancer binding protein gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CEBPG (CCAAT enhancer binding protein gamma)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cebpg (CCAAT enhancer binding protein gamma)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cebp-2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Irbp18
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
cebpg
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 96,820,981 - 96,829,736 (-) NCBI GRCr8 mRatBN7.2 1 87,683,060 - 87,692,772 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 87,684,019 - 87,694,569 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 93,083,770 - 93,090,520 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 101,549,756 - 101,556,506 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 94,842,069 - 94,848,819 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 91,286,956 - 91,297,459 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 91,287,917 - 91,296,656 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 92,417,890 - 92,442,666 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 87,552,695 - 87,559,447 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 87,630,805 - 87,637,558 (-) NCBI Celera 1 82,038,947 - 82,045,699 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cebpg Rat (+)-catechin increases expression ISO CEBPG (Homo sapiens) 6480464 Catechin results in increased expression of CEBPG mRNA CTD PMID:15465739 Cebpg Rat 1,2-dimethylhydrazine decreases expression ISO Cebpg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CEBPG mRNA CTD PMID:22206623 Cebpg Rat 1-nitropyrene increases expression ISO CEBPG (Homo sapiens) 6480464 1-nitropyrene results in increased expression of CEBPG mRNA CTD PMID:19041380 Cebpg Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CEBPG mRNA CTD PMID:17557909 Cebpg Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CEBPG mRNA CTD PMID:20068009 Cebpg Rat 17beta-estradiol decreases expression ISO Cebpg (Mus musculus) 6480464 Estradiol results in decreased expression of CEBPG mRNA CTD PMID:39298647 Cebpg Rat 17beta-estradiol increases expression ISO CEBPG (Homo sapiens) 6480464 Estradiol results in increased expression of CEBPG mRNA CTD PMID:24758408 and PMID:31614463 Cebpg Rat 17beta-estradiol multiple interactions ISO CEBPG (Homo sapiens) 6480464 EGF protein promotes the reaction [Estradiol results in increased expression of CEBPG mRNA] CTD PMID:24758408 Cebpg Rat 1H-pyrazole increases expression ISO Cebpg (Mus musculus) 6480464 pyrazole results in increased expression of CEBPG mRNA CTD PMID:17945193 Cebpg Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO CEBPG (Homo sapiens) 6480464 2 more ... CTD PMID:19095052 Cebpg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CEBPG mRNA CTD PMID:21215274 and PMID:33387578 Cebpg Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CEBPG mRNA CTD PMID:32109520 and PMID:34747641 Cebpg Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CEBPG (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CEBPG mRNA CTD PMID:20106945 and PMID:21632981 Cebpg Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cebpg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CEBPG mRNA CTD PMID:21570461 Cebpg Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Cebpg Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO CEBPG (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Cebpg Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of CEBPG mRNA CTD PMID:19643169 Cebpg Rat 2-hydroxypropanoic acid decreases expression ISO CEBPG (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CEBPG mRNA CTD PMID:30851411 Cebpg Rat 2-methoxyethanol increases expression EXP 6480464 methyl cellosolve results in increased expression of CEBPG mRNA CTD PMID:19643169 Cebpg Rat 2-methylcholine affects expression ISO CEBPG (Homo sapiens) 6480464 beta-methylcholine affects the expression of CEBPG mRNA CTD PMID:21179406 Cebpg Rat 4,4'-sulfonyldiphenol increases expression ISO Cebpg (Mus musculus) 6480464 bisphenol S results in increased expression of CEBPG mRNA CTD PMID:39298647 Cebpg Rat 4-hydroxyphenyl retinamide decreases expression ISO Cebpg (Mus musculus) 6480464 Fenretinide results in decreased expression of CEBPG mRNA CTD PMID:28973697 Cebpg Rat 8-Br-cAMP increases expression ISO CEBPG (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CEBPG mRNA CTD PMID:22079614 Cebpg Rat acrylamide increases expression ISO CEBPG (Homo sapiens) 6480464 Acrylamide results in increased expression of CEBPG mRNA CTD PMID:32763439 Cebpg Rat all-trans-retinoic acid decreases expression ISO CEBPG (Homo sapiens) 6480464 Tretinoin results in decreased expression of CEBPG mRNA CTD PMID:15498508 more ... Cebpg Rat AM-251 increases expression ISO CEBPG (Homo sapiens) 6480464 AM 251 results in increased expression of CEBPG mRNA CTD PMID:16500647 Cebpg Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CEBPG mRNA CTD PMID:16483693 Cebpg Rat antirheumatic drug increases expression ISO CEBPG (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CEBPG mRNA CTD PMID:24449571 Cebpg Rat arsane affects methylation ISO CEBPG (Homo sapiens) 6480464 Arsenic affects the methylation of CEBPG gene CTD PMID:25304211 Cebpg Rat arsenic atom affects methylation ISO CEBPG (Homo sapiens) 6480464 Arsenic affects the methylation of CEBPG gene CTD PMID:25304211 Cebpg Rat arsenite(3-) multiple interactions ISO CEBPG (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to CEBPG mRNA] CTD PMID:32406909 Cebpg Rat astemizole decreases expression EXP 6480464 Astemizole results in decreased expression of CEBPG mRNA CTD PMID:20221588 Cebpg Rat baicalein decreases expression ISO Cebpg (Mus musculus) 6480464 baicalein results in decreased expression of CEBPG mRNA CTD PMID:24560969 Cebpg Rat benzo[a]pyrene increases expression ISO Cebpg (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CEBPG mRNA CTD PMID:21569818 Cebpg Rat benzo[a]pyrene affects methylation ISO CEBPG (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CEBPG 5' UTR CTD PMID:27901495 Cebpg Rat benzo[a]pyrene increases methylation ISO CEBPG (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CEBPG promoter CTD PMID:27901495 Cebpg Rat benzo[a]pyrene decreases expression ISO CEBPG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CEBPG mRNA CTD PMID:20106945 and PMID:21632981 Cebpg Rat benzo[a]pyrene diol epoxide I decreases expression ISO CEBPG (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Cebpg Rat benzo[a]pyrene diol epoxide I increases expression ISO CEBPG (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Cebpg Rat beta-lapachone increases expression ISO CEBPG (Homo sapiens) 6480464 beta-lapachone results in increased expression of CEBPG mRNA CTD PMID:38218311 Cebpg Rat bexarotene decreases expression ISO CEBPG (Homo sapiens) 6480464 bexarotene results in decreased expression of CEBPG mRNA CTD PMID:17178900 Cebpg Rat bisphenol A decreases expression ISO CEBPG (Homo sapiens) 6480464 bisphenol A results in decreased expression of CEBPG mRNA CTD PMID:20678512 Cebpg Rat bisphenol A affects expression ISO CEBPG (Homo sapiens) 6480464 bisphenol A affects the expression of CEBPG mRNA CTD PMID:30903817 Cebpg Rat bisphenol A increases expression ISO CEBPG (Homo sapiens) 6480464 bisphenol A results in increased expression of CEBPG mRNA CTD PMID:29275510 Cebpg Rat bisphenol A affects methylation ISO Cebpg (Mus musculus) 6480464 bisphenol A affects the methylation of CEBPG promoter CTD PMID:27334623 Cebpg Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CEBPG mRNA CTD PMID:25181051 and PMID:30816183 Cebpg Rat butan-1-ol multiple interactions ISO CEBPG (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of CEBPG mRNA CTD PMID:29432896 Cebpg Rat cadmium dichloride increases expression ISO CEBPG (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CEBPG mRNA CTD PMID:38568856 Cebpg Rat carbon nanotube increases expression ISO Cebpg (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Cebpg Rat chloropicrin affects expression ISO CEBPG (Homo sapiens) 6480464 chloropicrin affects the expression of CEBPG mRNA CTD PMID:26352163 Cebpg Rat cisplatin multiple interactions ISO CEBPG (Homo sapiens) 6480464 Cisplatin promotes the reaction [Piroxicam results in decreased expression of CEBPG mRNA] CTD PMID:21858171 Cebpg Rat cisplatin increases expression ISO CEBPG (Homo sapiens) 6480464 Cisplatin results in increased expression of CEBPG mRNA CTD PMID:27594783 Cebpg Rat cobalt dichloride increases expression ISO CEBPG (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CEBPG mRNA CTD PMID:19376846 Cebpg Rat copper atom multiple interactions ISO CEBPG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CEBPG mRNA CTD PMID:20971185 Cebpg Rat copper(0) multiple interactions ISO CEBPG (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of CEBPG mRNA CTD PMID:20971185 Cebpg Rat copper(II) sulfate increases expression ISO CEBPG (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CEBPG mRNA CTD PMID:19549813 Cebpg Rat crocidolite asbestos affects expression ISO CEBPG (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of CEBPG mRNA CTD PMID:25757056 Cebpg Rat CU-O LINKAGE increases expression ISO CEBPG (Homo sapiens) 6480464 cupric oxide results in increased expression of CEBPG mRNA CTD PMID:22077320 Cebpg Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CEBPG mRNA CTD PMID:27523638 Cebpg Rat cyclosporin A increases expression ISO CEBPG (Homo sapiens) 6480464 Cyclosporine results in increased expression of CEBPG mRNA CTD PMID:20106945 more ... Cebpg Rat DDE decreases expression ISO CEBPG (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of CEBPG mRNA CTD PMID:38568856 Cebpg Rat Dibutyl phosphate affects expression ISO CEBPG (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CEBPG mRNA CTD PMID:37042841 Cebpg Rat diclofenac decreases expression ISO Cebpg (Mus musculus) 6480464 Diclofenac results in decreased expression of CEBPG mRNA CTD PMID:35537566 Cebpg Rat Didecyldimethylammonium increases expression ISO CEBPG (Homo sapiens) 6480464 didecyldimethylammonium results in increased expression of CEBPG mRNA CTD PMID:32763356 Cebpg Rat diisononyl phthalate increases expression ISO Cebpg (Mus musculus) 6480464 diisononyl phthalate results in increased expression of CEBPG mRNA CTD PMID:31546122 Cebpg Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of CEBPG mRNA CTD PMID:17720352 Cebpg Rat Diosbulbin B decreases expression ISO Cebpg (Mus musculus) 6480464 diosbulbin B results in decreased expression of CEBPG mRNA CTD PMID:39368342 Cebpg Rat disodium selenite increases expression ISO CEBPG (Homo sapiens) 6480464 Sodium Selenite results in increased expression of CEBPG mRNA CTD PMID:18175754 Cebpg Rat diuron increases expression EXP 6480464 Diuron results in increased expression of CEBPG mRNA CTD PMID:21551480 Cebpg Rat fenthion increases expression ISO Cebpg (Mus musculus) 6480464 Fenthion results in increased expression of CEBPG mRNA CTD PMID:34813904 Cebpg Rat flavonoids decreases expression ISO CEBPG (Homo sapiens) 6480464 Flavonoids results in decreased expression of CEBPG mRNA CTD PMID:15465739 Cebpg Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of CEBPG mRNA CTD PMID:18035473 Cebpg Rat fluoranthene multiple interactions ISO Cebpg (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of CEBPG mRNA CTD PMID:28329830 Cebpg Rat flusilazole affects expression ISO Cebpg (Mus musculus) 6480464 flusilazole affects the expression of CEBPG mRNA CTD PMID:21195148 Cebpg Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CEBPG mRNA CTD PMID:33387578 Cebpg Rat geraniol increases expression ISO CEBPG (Homo sapiens) 6480464 geraniol results in increased expression of CEBPG mRNA CTD PMID:27683099 Cebpg Rat hexaconazole affects expression ISO Cebpg (Mus musculus) 6480464 hexaconazole affects the expression of CEBPG mRNA CTD PMID:21195148 Cebpg Rat hydrogen peroxide affects expression ISO CEBPG (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CEBPG mRNA CTD PMID:20044591 Cebpg Rat inulin multiple interactions ISO Cebpg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CEBPG mRNA CTD PMID:36331819 Cebpg Rat isoprenaline increases expression ISO Cebpg (Mus musculus) 6480464 Isoproterenol results in increased expression of CEBPG mRNA CTD PMID:20003209 Cebpg Rat leflunomide increases expression ISO CEBPG (Homo sapiens) 6480464 leflunomide results in increased expression of CEBPG mRNA CTD PMID:28988120 Cebpg Rat lipopolysaccharide multiple interactions ISO Cebpg (Mus musculus) 6480464 3 more ... CTD PMID:17316017 Cebpg Rat lipopolysaccharide increases expression ISO Cebpg (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of CEBPG mRNA and Lipopolysaccharides results in increased expression of CEBPG protein CTD PMID:17316017 Cebpg Rat malathion increases expression ISO CEBPG (Homo sapiens) 6480464 Malathion results in increased expression of CEBPG mRNA CTD PMID:32069766 Cebpg Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of CEBPG mRNA CTD PMID:30467583 Cebpg Rat methyl methanesulfonate increases expression ISO CEBPG (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CEBPG mRNA CTD PMID:23649840 Cebpg Rat methylmercury chloride increases expression ISO CEBPG (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CEBPG mRNA CTD PMID:28001369 Cebpg Rat mitomycin C decreases expression ISO Cebpg (Mus musculus) 6480464 Mitomycin results in decreased expression of CEBPG mRNA CTD PMID:25270620 Cebpg Rat mono(2-ethylhexyl) phthalate decreases expression ISO CEBPG (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of CEBPG mRNA CTD PMID:38685446 Cebpg Rat N(4)-hydroxycytidine decreases expression ISO Cebpg (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of CEBPG mRNA CTD PMID:37748715 Cebpg Rat N-methyl-4-phenylpyridinium increases expression ISO CEBPG (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CEBPG mRNA CTD PMID:24810058 Cebpg Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CEBPG mRNA CTD PMID:28801915 Cebpg Rat nickel dichloride increases expression ISO CEBPG (Homo sapiens) 6480464 nickel chloride results in increased expression of CEBPG mRNA CTD PMID:17312168 Cebpg Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of CEBPG mRNA CTD PMID:23358140 Cebpg Rat paracetamol increases expression ISO CEBPG (Homo sapiens) 6480464 Acetaminophen results in increased expression of CEBPG mRNA CTD PMID:21420995 and PMID:29067470 Cebpg Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CEBPG mRNA CTD PMID:33387578 Cebpg Rat perfluorononanoic acid increases expression ISO CEBPG (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of CEBPG mRNA CTD PMID:32588087 Cebpg Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cebpg (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CEBPG mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of CEBPG mRNA CTD PMID:36331819 Cebpg Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of CEBPG mRNA CTD PMID:19162173 Cebpg Rat perfluorooctanoic acid increases expression ISO CEBPG (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of CEBPG mRNA CTD PMID:32588087 Cebpg Rat phenobarbital affects expression ISO CEBPG (Homo sapiens) 6480464 Phenobarbital affects the expression of CEBPG mRNA CTD PMID:19159669 Cebpg Rat phenobarbital affects expression ISO Cebpg (Mus musculus) 6480464 Phenobarbital affects the expression of CEBPG mRNA CTD PMID:23091169 Cebpg Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of CEBPG mRNA CTD PMID:19162173 Cebpg Rat piroxicam multiple interactions ISO CEBPG (Homo sapiens) 6480464 Cisplatin promotes the reaction [Piroxicam results in decreased expression of CEBPG mRNA] CTD PMID:21858171 Cebpg Rat piroxicam increases expression ISO CEBPG (Homo sapiens) 6480464 Piroxicam results in increased expression of CEBPG mRNA CTD PMID:21858171 Cebpg Rat progesterone increases expression ISO CEBPG (Homo sapiens) 6480464 Progesterone results in increased expression of CEBPG mRNA CTD PMID:18037150 Cebpg Rat rac-lactic acid decreases expression ISO CEBPG (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CEBPG mRNA CTD PMID:30851411 Cebpg Rat resveratrol multiple interactions ISO Cebpg (Mus musculus) 6480464 resveratrol inhibits the reaction [Lipopolysaccharides results in increased expression of CEBPG mRNA] and resveratrol inhibits the reaction [Lipopolysaccharides results in increased expression of CEBPG protein] CTD PMID:17316017 Cebpg Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO CEBPG (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of CEBPG mRNA CTD PMID:33725128 Cebpg Rat silver atom decreases expression ISO Cebpg (Mus musculus) 6480464 Silver results in decreased expression of CEBPG mRNA CTD PMID:27131904 Cebpg Rat silver(0) decreases expression ISO Cebpg (Mus musculus) 6480464 Silver results in decreased expression of CEBPG mRNA CTD PMID:27131904 Cebpg Rat sodium arsenite decreases expression ISO CEBPG (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CEBPG mRNA CTD PMID:28595984 and PMID:34032870 Cebpg Rat sodium arsenite increases expression ISO CEBPG (Homo sapiens) 6480464 sodium arsenite results in increased expression of CEBPG mRNA CTD PMID:38568856 Cebpg Rat sunitinib increases expression ISO CEBPG (Homo sapiens) 6480464 Sunitinib results in increased expression of CEBPG mRNA CTD PMID:31533062 Cebpg Rat tamibarotene decreases expression ISO CEBPG (Homo sapiens) 6480464 tamibarotene results in decreased expression of CEBPG mRNA CTD PMID:15498508 Cebpg Rat thapsigargin increases expression ISO CEBPG (Homo sapiens) 6480464 Thapsigargin results in increased expression of CEBPG mRNA CTD PMID:22378314 and PMID:29453283 Cebpg Rat thiram increases expression ISO CEBPG (Homo sapiens) 6480464 Thiram results in increased expression of CEBPG mRNA CTD PMID:38568856 Cebpg Rat titanium dioxide increases methylation ISO Cebpg (Mus musculus) 6480464 titanium dioxide results in increased methylation of CEBPG gene CTD PMID:35295148 Cebpg Rat triadimefon affects expression ISO Cebpg (Mus musculus) 6480464 triadimefon affects the expression of CEBPG mRNA CTD PMID:21195148 Cebpg Rat triphenyl phosphate affects expression ISO CEBPG (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CEBPG mRNA CTD PMID:37042841 Cebpg Rat triptonide decreases expression ISO Cebpg (Mus musculus) 6480464 triptonide results in decreased expression of CEBPG mRNA CTD PMID:33045310 Cebpg Rat troglitazone increases expression ISO Cebpg (Mus musculus) 6480464 troglitazone results in increased expression of CEBPG mRNA CTD PMID:24559133 Cebpg Rat trovafloxacin decreases expression ISO Cebpg (Mus musculus) 6480464 trovafloxacin results in decreased expression of CEBPG mRNA CTD PMID:35537566 Cebpg Rat tunicamycin increases expression ISO CEBPG (Homo sapiens) 6480464 Tunicamycin results in increased expression of CEBPG mRNA CTD PMID:22378314 and PMID:29453283 Cebpg Rat valproic acid affects expression ISO CEBPG (Homo sapiens) 6480464 Valproic Acid affects the expression of CEBPG mRNA CTD PMID:25979313 Cebpg Rat vorinostat decreases expression ISO CEBPG (Homo sapiens) 6480464 vorinostat results in decreased expression of CEBPG mRNA CTD PMID:22083351 Cebpg Rat zinc atom multiple interactions ISO CEBPG (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CEBPG mRNA CTD PMID:18593933 Cebpg Rat zinc(0) multiple interactions ISO CEBPG (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CEBPG mRNA CTD PMID:18593933
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-ethoxyethanol (EXP) 2-hydroxypropanoic acid (ISO) 2-methoxyethanol (EXP) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 8-Br-cAMP (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) AM-251 (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) astemizole (EXP) baicalein (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bexarotene (ISO) bisphenol A (EXP,ISO) butan-1-ol (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chloropicrin (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) Didecyldimethylammonium (ISO) diisononyl phthalate (ISO) dimethylarsinic acid (EXP) Diosbulbin B (ISO) disodium selenite (ISO) diuron (EXP) fenthion (ISO) flavonoids (EXP,ISO) fluoranthene (ISO) flusilazole (ISO) gentamycin (EXP) geraniol (ISO) hexaconazole (ISO) hydrogen peroxide (ISO) inulin (ISO) isoprenaline (ISO) leflunomide (ISO) lipopolysaccharide (ISO) malathion (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mitomycin C (ISO) mono(2-ethylhexyl) phthalate (ISO) N(4)-hydroxycytidine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) nickel dichloride (ISO) ochratoxin A (EXP) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenobarbital (ISO) pirinixic acid (EXP) piroxicam (ISO) progesterone (ISO) rac-lactic acid (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) sunitinib (ISO) tamibarotene (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) triadimefon (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) valproic acid (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
B cell differentiation (ISO,ISS) DNA-templated transcription (IEA) enucleate erythrocyte differentiation (ISO,ISS) immune response (ISO,ISS) liver development (IEP) mRNA metabolic process (ISO) natural killer cell mediated cytotoxicity (ISO,ISS) negative regulation of DNA-binding transcription factor activity (ISO,ISS) positive regulation of DNA repair (ISO,ISS) positive regulation of transcription by RNA polymerase II (ISO) positive regulation of type II interferon production (ISO,ISS) regulation of DNA-templated transcription (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEP,ISO)
Molecular Function
DNA binding (IDA,IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA) DNA-binding transcription factor binding (ISO,ISS) double-stranded DNA binding (IDA) protein binding (IPI,ISO) protein-containing complex binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding, bending (IDA) sequence-specific DNA binding (ISO,ISS) sequence-specific double-stranded DNA binding (ISO)
1.
Ig/EBP (C/EBP gamma) is a transdominant negative inhibitor of C/EBP family transcriptional activators.
Cooper C, etal., Nucleic Acids Res. 1995 Nov 11;23(21):4371-7.
2.
Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.
Davydov IV, etal., Gene. 1995 Aug 19;161(2):271-5.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
CEBPG transcription factor correlates with antioxidant and DNA repair genes in normal bronchial epithelial cells but not in individuals with bronchogenic carcinoma.
Mullins DN, etal., BMC Cancer. 2005 Oct 29;5:141.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Members of the C/EBP transcription factor family stimulate expression of the human and rat surfactant protein A (SP-A) genes.
Rosenberg E, etal., Biochim Biophys Acta 2002 May 3;1575(1-3):82-90.
11.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
12.
Molecular cloning of two C/EBP-related proteins that bind to the promoter and the enhancer of the alpha 1-fetoprotein gene. Further analysis of C/EBP beta and C/EBP gamma.
Thomassin H, etal., Nucleic Acids Res 1992 Jun 25;20(12):3091-8.
Cebpg (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 96,820,981 - 96,829,736 (-) NCBI GRCr8 mRatBN7.2 1 87,683,060 - 87,692,772 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 87,684,019 - 87,694,569 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 93,083,770 - 93,090,520 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 101,549,756 - 101,556,506 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 94,842,069 - 94,848,819 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 91,286,956 - 91,297,459 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 91,287,917 - 91,296,656 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 92,417,890 - 92,442,666 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 87,552,695 - 87,559,447 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 87,630,805 - 87,637,558 (-) NCBI Celera 1 82,038,947 - 82,045,699 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
CEBPG (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 33,373,709 - 33,382,686 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 33,373,685 - 33,382,686 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 33,864,615 - 33,873,592 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 38,556,449 - 38,565,432 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 38,556,448 - 38,565,431 NCBI Celera 19 30,558,181 - 30,567,164 (+) NCBI Celera Cytogenetic Map 19 q13.11 NCBI HuRef 19 30,365,211 - 30,374,228 (+) NCBI HuRef CHM1_1 19 33,865,529 - 33,874,546 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 35,893,494 - 35,902,471 (+) NCBI T2T-CHM13v2.0
Cebpg (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 34,745,847 - 34,755,991 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 34,745,847 - 34,755,998 (-) Ensembl GRCm39 Ensembl GRCm38 7 35,046,422 - 35,056,566 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 35,046,422 - 35,056,573 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 35,831,441 - 35,841,585 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 34,755,545 - 34,765,263 (-) NCBI MGSCv36 mm8 Celera 7 30,182,296 - 30,192,439 (-) NCBI Celera Cytogenetic Map 7 B2 NCBI cM Map 7 20.91 NCBI
Cebpg (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 3,137,106 - 3,141,733 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 3,137,106 - 3,141,733 (+) NCBI ChiLan1.0 ChiLan1.0
CEBPG (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 39,345,539 - 39,354,475 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 41,345,573 - 41,354,513 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 30,295,603 - 30,304,984 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 39,039,837 - 39,049,671 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 39,046,219 - 39,046,671 (+) Ensembl panpan1.1 panPan2
CEBPG (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 118,777,110 - 118,784,397 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 118,778,224 - 118,778,667 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 118,176,203 - 118,186,035 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 119,373,710 - 119,383,542 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 119,376,715 - 119,377,158 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 118,934,395 - 118,944,213 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 118,560,906 - 118,570,734 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 119,619,593 - 119,629,416 (-) NCBI UU_Cfam_GSD_1.0
Cebpg (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 9,201,634 - 9,210,667 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936570 2,438,187 - 2,438,639 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936570 2,435,672 - 2,439,056 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CEBPG (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 43,164,919 - 43,174,990 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 43,164,902 - 43,175,002 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 38,712,133 - 38,722,192 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CEBPG (Chlorocebus sabaeus - green monkey)
Cebpg (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 1423 Count of miRNA genes: 355 Interacting mature miRNAs: 508 Transcripts: ENSRNOT00000028703 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2300324 Fetw1 Fetal weight QTL 1 12.1 0.005 fetal growth trait (VT:0004201) fetal body weight (CMO:0002080) 1 85424647 100358001 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat
RH127434
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,684,222 - 87,684,402 (+) MAPPER mRatBN7.2 Rnor_6.0 1 91,288,118 - 91,288,297 NCBI Rnor6.0 Rnor_5.0 1 92,419,053 - 92,419,232 UniSTS Rnor5.0 RGSC_v3.4 1 87,550,898 - 87,551,077 UniSTS RGSC3.4 Celera 1 82,037,150 - 82,037,329 UniSTS RH 3.4 Map 1 861.7 UniSTS Cytogenetic Map 1 q21 UniSTS
RH129375
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,684,082 - 87,684,237 (+) MAPPER mRatBN7.2 Rnor_6.0 1 91,287,978 - 91,288,132 NCBI Rnor6.0 Rnor_5.0 1 92,418,913 - 92,419,067 UniSTS Rnor5.0 RGSC_v3.4 1 87,550,758 - 87,550,912 UniSTS RGSC3.4 Celera 1 82,037,010 - 82,037,164 UniSTS RH 3.4 Map 1 862.7 UniSTS Cytogenetic Map 1 q21 UniSTS
RH132653
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,686,596 - 87,686,781 (+) MAPPER mRatBN7.2 Rnor_6.0 1 91,290,492 - 91,290,676 NCBI Rnor6.0 Rnor_5.0 1 92,421,427 - 92,421,611 UniSTS Rnor5.0 RGSC_v3.4 1 87,553,272 - 87,553,456 UniSTS RGSC3.4 Celera 1 82,039,524 - 82,039,708 UniSTS RH 3.4 Map 1 862.0 UniSTS Cytogenetic Map 1 q21 UniSTS
RH94774
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,686,019 - 87,686,280 (+) MAPPER mRatBN7.2 Rnor_6.0 1 91,289,915 - 91,290,175 NCBI Rnor6.0 Rnor_5.0 1 92,420,850 - 92,421,110 UniSTS Rnor5.0 RGSC_v3.4 1 87,552,695 - 87,552,955 UniSTS RGSC3.4 Celera 1 82,038,947 - 82,039,207 UniSTS Cytogenetic Map 1 q21 UniSTS
PMC305797P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 87,686,726 - 87,687,204 (+) MAPPER mRatBN7.2 Rnor_6.0 1 91,290,622 - 91,291,099 NCBI Rnor6.0 Rnor_5.0 1 92,421,557 - 92,422,034 UniSTS Rnor5.0 RGSC_v3.4 1 87,553,402 - 87,553,879 UniSTS RGSC3.4 Celera 1 82,039,654 - 82,040,131 UniSTS Cytogenetic Map 1 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028703 ⟹ ENSRNOP00000028703
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 87,684,019 - 87,694,569 (-) Ensembl Rnor_6.0 Ensembl 1 91,287,917 - 91,296,656 (-) Ensembl
RefSeq Acc Id:
NM_012831 ⟹ NP_036963
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 96,822,984 - 96,829,736 (-) NCBI mRatBN7.2 1 87,686,020 - 87,692,772 (-) NCBI Rnor_6.0 1 91,289,915 - 91,296,667 (-) NCBI Rnor_5.0 1 92,417,890 - 92,442,666 (-) NCBI RGSC_v3.4 1 87,552,695 - 87,559,447 (-) RGD Celera 1 82,038,947 - 82,045,699 (-) RGD
Sequence:
GGCCGCGGTGGCGGAACGGGCGGAGGCTGCCGGTTTCGTAACCGTCGCTCCTCCTCGCCGACTCGCAGGCTGCGAGGCCTGGGTAGGGTCGGACCGCGCCGCGCGGGGCCGCTCGGAGTGGAGGCCGT CTGGGGGCGGGCGGGCCGGCCGGAGGCGCAGGTACATGTGAAGATTTTTTGGCAGTTGAGTGTGGCCTTCTCGGATCACACTGCTCTGATTTCTACGTGTTCTGTGTTGGTGGAGGAACGGGCCCAAA TGAGCAAGCTGTCGCAGCCAGCCTCGACTGCAGGAGTGAACGGGATCAGTGTCATTCACACTCAGGCACATGCCAGCGGCTTACAGCAGGTTCCTCAGCTGGTGCCCGCTGGGCCTGGGGGAGGAGGC AAAGCTGTGCCTCCAAGCAAGCAAAGCAAGAAGAGCTCACCCATGGATCGAAATAGCGATGAGTACCGCCAGCGCAGAGAGCGGAACAATATGGCTGTGAAAAAGAGCCGGTTAAAAAGCAAGCAGAA AGCTCAAGATACACTGCAGAGAGTAAACCAGCTCAAGGAGGAGAACGAGCGGCTGGAAGCCAAAATTAAGTTGCTGACAAAGGAATTAAGTGTACTGAAAGACTTGTTTCTTGAGCATGCGCACAACC TCGCAGACAATGTGCAGCCCATCAGCACGGAAACTACGGTGGCAAATTCTGATAACACAGGGCAGTAGATCTCCTTCCAGGCGCCACAGCCTTGTGACTTGAACATGAGAGGTGTGACCACCCTGCAC CCCTTGGTTCAGTGGCTGAGCTCGGTCTTGTTCCATTGGAGGTTATTTTTTAGGCTCAGCACTGGACAGCTGGTTAGCCATGTAATTTATCTGGTCTTAAATGATAATGGATTTTTGAAGCACTAAAA GAAAACTTAGGGTTTATGGTTAAAATAAAATTCCTGGCCTTTAATATTCTTAATAAATCCTCACTTCCCCAGAAATGCTTCTTTTGTAGGAAGGGGAAAATGGAAGGTCATATTGAAGGTTCTGGGTT CTAATGAGATAATACCTTGGACTAGGAAAAGCTGAATTCCATCTGTGTTCTTCAATTTGTGATTTTATTCTAAATTGTGTATGATAAATTCTAGGGCTATAGAAACCAGCCATAATAATTTGGCCCAA TTTTATAGATGTATAAACCTGTGTTAGCATAATCAGCATCGTTTTTTCCAACACATACACATTTTAAAAAATGACCTTAGGTGAAGTAAAGAAATCCCATCAGGTCACGTCGAGAGGTGGTTAAAAAT ACAAGTTGTGTTTAGGAAGGAAAGAGGTGGTTTTGTGCTTTTCCCCCTTGTTTGTTTTAAAGGGCATAGAGTGTGATTGAACTTTGGGGGGCCTTCTGCTTATTGGATGAGCATTATCTGTATCCTAA AAGACAGTAGCCACCGTGTACT
hide sequence
RefSeq Acc Id:
XM_039101538 ⟹ XP_038957466
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 96,820,981 - 96,829,544 (-) NCBI mRatBN7.2 1 87,683,060 - 87,692,579 (-) NCBI
RefSeq Acc Id:
NP_036963 ⟸ NM_012831
- UniProtKB:
P26801 (UniProtKB/Swiss-Prot), B2GVA2 (UniProtKB/TrEMBL)
- Sequence:
MSKLSQPASTAGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVPPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHN LADNVQPISTETTVANSDNTGQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000028703 ⟸ ENSRNOT00000028703
RefSeq Acc Id:
XP_038957466 ⟸ XM_039101538
- Peptide Label:
isoform X1
- UniProtKB:
P26801 (UniProtKB/Swiss-Prot), B2GVA2 (UniProtKB/TrEMBL)
RGD ID: 13689964
Promoter ID: EPDNEW_R487
Type: initiation region
Name: Cebpg_1
Description: CCAAT/enhancer binding protein gamma
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 91,296,614 - 91,296,674 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-13
Cebpg
CCAAT/enhancer binding protein gamma
Cebpg
CCAAT/enhancer binding protein (C/EBP), gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Cebpg
CCAAT/enhancer binding protein (C/EBP), gamma
CCAAT/enhancer binding protein ,gamma
Name updated
1299863
APPROVED
2002-11-06
Cebpg
CCAAT/enhancer binding protein ,gamma
CCAAT/enhancer binding protein (C/EBP), gamma
Name updated
625702
APPROVED
2001-07-23
Cebpg
Rat homolog to a human CCAAT/enhancer binding protein - gamma
Name withdrawn
67952
WITHDRAWN
2001-07-23
Cebpg
CCAAT/enhancer binding protein (C/EBP), gamma
Name updated to reflect Human and Mouse nomenclature
67952
APPROVED