Symbol:
Phf6
Name:
PHD finger protein 6
RGD ID:
2323526
Description:
Predicted to enable several functions, including histone binding activity; histone deacetylase binding activity; and scaffold protein binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within blastocyst hatching. Predicted to be located in nucleolus and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Borjeson-Forssman-Lehmann syndrome; acute myeloid leukemia; and congestive heart failure. Orthologous to human PHF6 (PHD finger protein 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; thioacetamide; (-)-demecolcine (ortholog).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC100359714; LOC103690175
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PHF6 (PHD finger protein 6) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Phf6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Phf6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PHF6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PHF6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Phf6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PHF6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PHF6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Phf6 (PHD finger protein 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PHF6 (PHD finger protein 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Phf6 (PHD finger protein 6)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
phf6 (PHD finger protein 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
phf6
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 137,576,214 - 137,619,297 (+) NCBI GRCr8 mRatBN7.2 X 132,656,658 - 132,699,720 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 132,656,672 - 132,699,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 134,816,738 - 134,859,802 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 138,399,577 - 138,442,639 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 135,965,278 - 136,008,343 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 158,698,353 - 158,739,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,698,356 - 158,739,838 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,268,653 - 158,288,109 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 152,890,577 - 152,930,657 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 X 153,324,996 - 153,366,506 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 139,850,136 - 139,890,670 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Cytogenetic Map X q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Phf6 Rat (-)-demecolcine decreases expression ISO PHF6 (Homo sapiens) 6480464 Demecolcine results in decreased expression of PHF6 mRNA CTD PMID:23649840 Phf6 Rat 1,2-dimethylhydrazine increases expression ISO Phf6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PHF6 mRNA CTD PMID:22206623 Phf6 Rat 1,2-dimethylhydrazine multiple interactions ISO Phf6 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PHF6 mRNA CTD PMID:22206623 Phf6 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO PHF6 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of PHF6 mRNA CTD PMID:29581250 Phf6 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Phf6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Phf6 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Phf6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Phf6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Phf6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PHF6 mRNA CTD PMID:21570461 Phf6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PHF6 mRNA CTD PMID:33387578 Phf6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Phf6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PHF6 mRNA CTD PMID:20188158 Phf6 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Phf6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PHF6 mRNA CTD PMID:26251327 Phf6 Rat 4-hydroxyphenyl retinamide increases expression ISO Phf6 (Mus musculus) 6480464 Fenretinide results in increased expression of PHF6 mRNA CTD PMID:28973697 Phf6 Rat acetohydrazide decreases expression ISO Phf6 (Mus musculus) 6480464 acetylhydrazine results in decreased expression of PHF6 mRNA CTD PMID:15282401 Phf6 Rat aflatoxin B1 decreases methylation ISO PHF6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PHF6 intron CTD PMID:30157460 Phf6 Rat all-trans-retinoic acid decreases expression ISO PHF6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PHF6 mRNA CTD PMID:33167477 Phf6 Rat arsenite(3-) multiple interactions ISO PHF6 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PHF6 mRNA] CTD PMID:32406909 Phf6 Rat benzo[a]pyrene increases expression ISO Phf6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PHF6 mRNA CTD PMID:22228805 Phf6 Rat benzo[a]pyrene affects methylation ISO PHF6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PHF6 5' UTR more ... CTD PMID:27901495 Phf6 Rat bisphenol A decreases expression ISO PHF6 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PHF6 protein CTD PMID:37567409 Phf6 Rat cadmium dichloride increases expression ISO PHF6 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PHF6 mRNA CTD PMID:26472689 Phf6 Rat cadmium dichloride decreases expression ISO PHF6 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PHF6 mRNA CTD PMID:38568856 Phf6 Rat caffeine decreases phosphorylation ISO PHF6 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of PHF6 protein CTD PMID:35688186 Phf6 Rat chlordecone multiple interactions ISO Phf6 (Mus musculus) 6480464 Chlordecone inhibits the reaction [Biomarkers metabolite binds to PHF6 gene] CTD PMID:31084621 Phf6 Rat copper(II) sulfate increases expression ISO PHF6 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PHF6 mRNA CTD PMID:19549813 Phf6 Rat cyclosporin A decreases expression ISO PHF6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PHF6 mRNA CTD PMID:25562108 Phf6 Rat dicrotophos decreases expression ISO PHF6 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PHF6 mRNA CTD PMID:28302478 Phf6 Rat diethylstilbestrol increases expression ISO PHF6 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of PHF6 mRNA CTD PMID:36621641 Phf6 Rat dimethyl sulfoxide affects expression ISO PHF6 (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of PHF6 mRNA CTD PMID:24834073 Phf6 Rat dorsomorphin multiple interactions ISO PHF6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PHF6 mRNA CTD PMID:27188386 Phf6 Rat enzyme inhibitor multiple interactions ISO PHF6 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PHF6 protein CTD PMID:23301498 Phf6 Rat folic acid multiple interactions ISO Phf6 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of PHF6 mRNA CTD PMID:22206623 Phf6 Rat FR900359 affects phosphorylation ISO PHF6 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of PHF6 protein CTD PMID:37730182 Phf6 Rat hydrogen peroxide increases expression ISO PHF6 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of PHF6 mRNA CTD PMID:18951874 Phf6 Rat hydrogen peroxide increases secretion ISO Phf6 (Mus musculus) 6480464 Hydrogen Peroxide results in increased secretion of PHF6 mRNA CTD PMID:21179422 Phf6 Rat indinavir multiple interactions ISO Phf6 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of PHF6 mRNA CTD PMID:16931933 Phf6 Rat ivermectin decreases expression ISO PHF6 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PHF6 protein CTD PMID:32959892 Phf6 Rat ketoconazole increases expression ISO PHF6 (Homo sapiens) 6480464 Ketoconazole results in increased expression of PHF6 mRNA CTD PMID:36621641 Phf6 Rat lamivudine multiple interactions ISO Phf6 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of PHF6 mRNA more ... CTD PMID:16931933 Phf6 Rat methidathion decreases expression ISO Phf6 (Mus musculus) 6480464 methidathion results in decreased expression of PHF6 mRNA CTD PMID:34813904 Phf6 Rat methotrexate increases expression ISO PHF6 (Homo sapiens) 6480464 Methotrexate results in increased expression of PHF6 mRNA CTD PMID:24449571 Phf6 Rat paracetamol increases expression ISO PHF6 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PHF6 mRNA CTD PMID:22230336 Phf6 Rat PCB138 multiple interactions ISO Phf6 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Phf6 Rat pentachlorophenol increases expression ISO Phf6 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of PHF6 mRNA CTD PMID:23892564 Phf6 Rat perfluorooctane-1-sulfonic acid decreases expression ISO PHF6 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PHF6 mRNA CTD PMID:27153767 Phf6 Rat resveratrol multiple interactions ISO PHF6 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PHF6 mRNA CTD PMID:23557933 Phf6 Rat saquinavir multiple interactions ISO Phf6 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in decreased expression of PHF6 mRNA CTD PMID:16931933 Phf6 Rat SB 431542 multiple interactions ISO PHF6 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Phf6 Rat silicon dioxide increases methylation ISO PHF6 (Homo sapiens) 6480464 Silicon Dioxide results in increased methylation of PHF6 gene CTD PMID:34973136 Phf6 Rat succimer multiple interactions ISO Phf6 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of PHF6 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of PHF6 mRNA CTD PMID:21641980 and PMID:26378955 Phf6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PHF6 mRNA CTD PMID:34492290 Phf6 Rat titanium dioxide decreases expression ISO Phf6 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PHF6 mRNA CTD PMID:29264374 Phf6 Rat titanium dioxide decreases methylation ISO Phf6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PHF6 gene CTD PMID:35295148 Phf6 Rat trichostatin A decreases expression ISO PHF6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PHF6 mRNA CTD PMID:24935251 Phf6 Rat trichostatin A multiple interactions ISO PHF6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PHF6 mRNA CTD PMID:27188386 Phf6 Rat triphenyl phosphate affects expression ISO PHF6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PHF6 mRNA CTD PMID:37042841 Phf6 Rat urethane decreases expression ISO PHF6 (Homo sapiens) 6480464 Urethane results in decreased expression of PHF6 mRNA CTD PMID:28818685 Phf6 Rat valproic acid affects expression ISO Phf6 (Mus musculus) 6480464 Valproic Acid affects the expression of PHF6 mRNA CTD PMID:17963808 Phf6 Rat valproic acid decreases expression ISO PHF6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PHF6 mRNA CTD PMID:23179753 more ... Phf6 Rat vincristine decreases expression ISO PHF6 (Homo sapiens) 6480464 Vincristine results in decreased expression of PHF6 mRNA CTD PMID:23649840 Phf6 Rat vorinostat decreases expression ISO PHF6 (Homo sapiens) 6480464 vorinostat results in decreased expression of PHF6 mRNA CTD PMID:27188386 Phf6 Rat zidovudine multiple interactions ISO Phf6 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in decreased expression of PHF6 mRNA more ... CTD PMID:16931933
(-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-hydroxyphenyl retinamide (ISO) acetohydrazide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (ISO) cadmium dichloride (ISO) caffeine (ISO) chlordecone (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) dimethyl sulfoxide (ISO) dorsomorphin (ISO) enzyme inhibitor (ISO) folic acid (ISO) FR900359 (ISO) hydrogen peroxide (ISO) indinavir (ISO) ivermectin (ISO) ketoconazole (ISO) lamivudine (ISO) methidathion (ISO) methotrexate (ISO) paracetamol (ISO) PCB138 (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) resveratrol (ISO) saquinavir (ISO) SB 431542 (ISO) silicon dioxide (ISO) succimer (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vincristine (ISO) vorinostat (ISO) zidovudine (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Full spectrum of clonal haematopoiesis-driver mutations in chronic heart failure and their associations with mortality.
Kiefer KC, etal., ESC Heart Fail. 2021 Jun;8(3):1873-1884. doi: 10.1002/ehf2.13297. Epub 2021 Mar 28.
3.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
4.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Comprehensive gene review and curation
RGD comprehensive gene curation
7.
The co-regulatory networks of tumor suppressor genes, oncogenes, and miRNAs in colorectal cancer.
Slattery ML, etal., Genes Chromosomes Cancer. 2017 Nov;56(11):769-787. doi: 10.1002/gcc.22481. Epub 2017 Jul 30.
8.
Downregulation of PHF6 Inhibits Cell Proliferation and Migration in Hepatocellular Carcinoma.
Yu Q, etal., Cancer Biother Radiopharm. 2019 May;34(4):245-251. doi: 10.1089/cbr.2018.2671. Epub 2019 Mar 19.
9.
MicroRNA-214 suppresses cell proliferation and migration and cell metabolism by targeting PDK2 and PHF6 in hepatocellular carcinoma.
Yu Q, etal., Cell Biol Int. 2019 Jul 22. doi: 10.1002/cbin.11207.
10.
High expression of microRNA-500 is associated with poor prognosis in patients with acute myeloid leukemia receiving allogeneic hematopoietic stem cell transplantation.
Zhang G, etal., Oncol Lett. 2019 Jun;17(6):5815-5820. doi: 10.3892/ol.2019.10250. Epub 2019 Apr 15.
Phf6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 137,576,214 - 137,619,297 (+) NCBI GRCr8 mRatBN7.2 X 132,656,658 - 132,699,720 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 132,656,672 - 132,699,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 134,816,738 - 134,859,802 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 138,399,577 - 138,442,639 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 135,965,278 - 136,008,343 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 158,698,353 - 158,739,855 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,698,356 - 158,739,838 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 158,268,653 - 158,288,109 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 152,890,577 - 152,930,657 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 X 153,324,996 - 153,366,506 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 139,850,136 - 139,890,670 NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Cytogenetic Map X q36 NCBI
PHF6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 134,373,312 - 134,428,790 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 134,373,288 - 134,428,791 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 133,507,342 - 133,562,820 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 133,335,008 - 133,390,488 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 133,232,861 - 133,288,339 NCBI Celera X 133,894,183 - 133,949,652 (+) NCBI Celera Cytogenetic Map X q26.2 NCBI HuRef X 122,905,958 - 122,961,468 (+) NCBI HuRef CHM1_1 X 133,419,127 - 133,474,595 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 132,698,463 - 132,753,940 (+) NCBI T2T-CHM13v2.0
Phf6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 52,001,091 - 52,045,838 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 52,001,143 - 52,045,820 (+) Ensembl GRCm39 Ensembl GRCm38 X 52,912,214 - 52,956,961 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 52,912,266 - 52,956,943 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 50,265,443 - 50,310,120 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 49,156,893 - 49,201,570 (+) NCBI MGSCv36 mm8 Celera X 40,338,044 - 40,382,845 (+) NCBI Celera Cytogenetic Map X A5 NCBI cM Map X 29.28 NCBI
Phf6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955473 527,005 - 586,627 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955473 527,005 - 586,589 (-) NCBI ChiLan1.0 ChiLan1.0
PHF6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 133,808,035 - 133,864,349 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 133,811,627 - 133,867,947 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 123,521,956 - 123,578,256 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 133,822,260 - 133,877,452 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 133,822,260 - 133,873,990 (+) Ensembl panpan1.1 panPan2
PHF6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 105,044,232 - 105,093,663 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 105,043,556 - 105,091,795 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 91,154,612 - 91,205,687 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 106,904,096 - 106,955,183 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 106,904,172 - 106,955,712 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 104,317,141 - 104,368,210 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 106,183,139 - 106,234,213 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 105,974,494 - 106,025,566 (+) NCBI UU_Cfam_GSD_1.0
Phf6
PHF6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 110,249,010 - 110,303,017 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 110,249,010 - 110,311,503 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 126,334,888 - 126,353,998 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PHF6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 109,531,700 - 109,595,136 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 109,531,726 - 109,593,854 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 47,136,942 - 47,193,137 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Phf6
.
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 634346 Insul4 Insulin level QTL 4 0 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) X 126975089 152453651 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
DXGot147
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 132,678,804 - 132,678,960 (-) MAPPER mRatBN7.2 Rnor_6.0 X 158,286,030 - 158,286,183 NCBI Rnor6.0 Rnor_6.0 X 158,719,113 - 158,719,266 NCBI Rnor6.0 Rnor_5.0 X 153,345,756 - 153,345,909 UniSTS Rnor5.0 Rnor_5.0 X 152,911,337 - 152,911,490 UniSTS Rnor5.0 RGSC_v3.4 X 139,872,279 - 139,872,432 UniSTS RGSC3.4 Cytogenetic Map X RGD
AW549906
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 132,699,109 - 132,699,250 (-) MAPPER mRatBN7.2 Rnor_6.0 X 158,265,740 - 158,265,880 NCBI Rnor6.0 Rnor_6.0 X 158,698,823 - 158,698,963 NCBI Rnor6.0 Rnor_5.0 X 153,325,466 - 153,325,606 UniSTS Rnor5.0 Rnor_5.0 X 152,891,047 - 152,891,187 UniSTS Rnor5.0 RGSC_v3.4 X 139,892,582 - 139,892,722 UniSTS RGSC3.4
RH139307
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 132,685,648 - 132,685,847 (-) MAPPER mRatBN7.2 Rnor_6.0 X 158,279,143 - 158,279,341 NCBI Rnor6.0 Rnor_6.0 X 158,712,226 - 158,712,424 NCBI Rnor6.0 Rnor_5.0 X 153,338,869 - 153,339,067 UniSTS Rnor5.0 Rnor_5.0 X 152,904,450 - 152,904,648 UniSTS Rnor5.0 RGSC_v3.4 X 139,879,121 - 139,879,319 UniSTS RGSC3.4
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
43
82
57
60
41
19
41
160
73
74
35
41
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003091 ⟹ ENSRNOP00000003091
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,656,716 - 132,699,127 (+) Ensembl Rnor_6.0 Ensembl X 158,698,356 - 158,739,838 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000072527 ⟹ ENSRNOP00000064143
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 132,656,672 - 132,699,127 (+) Ensembl Rnor_6.0 Ensembl X 158,268,653 - 158,288,109 (-) Ensembl
RefSeq Acc Id:
NM_001402228 ⟹ NP_001389157
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 137,576,240 - 137,619,297 (+) NCBI mRatBN7.2 X 132,656,659 - 132,699,720 (+) NCBI
RefSeq Acc Id:
XM_017602432 ⟹ XP_017457921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 137,576,254 - 137,619,297 (+) NCBI mRatBN7.2 X 132,656,658 - 132,699,720 (+) NCBI Rnor_6.0 X 158,698,353 - 158,739,854 (-) NCBI
Sequence:
CGTGTGCGTACGGAGGGAGGCAACGTAAGGGCGCTCGGCCAGCCCGTCTCTCCTCGAATGAAAGGAAACAACCCCTGGCAACAGAGCTCCGCTCTTCGGCACTGCCGGAGAACCGACTCCCGCCTTCC
hide sequence
RefSeq Acc Id:
XM_039100498 ⟹ XP_038956426
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 137,576,214 - 137,619,297 (+) NCBI mRatBN7.2 X 132,656,658 - 132,699,720 (+) NCBI
RefSeq Acc Id:
XP_017457921 ⟸ XM_017602432
- Peptide Label:
isoform X2
- UniProtKB:
M0R464 (UniProtKB/TrEMBL)
- Sequence:
MCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPSQGIYMVYCRKHKKTAHNSEADLEESFNEHELEPSSPKTKKKSRKGRPRKTNLKGLAEDTRSTSSHGTDETESSSYRDRSPHRSSPNDT
hide sequence
RefSeq Acc Id:
XP_038956426 ⟸ XM_039100498
- Peptide Label:
isoform X1
- UniProtKB:
D3ZQV8 (UniProtKB/TrEMBL), A6KUK6 (UniProtKB/TrEMBL), M0R464 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000003091 ⟸ ENSRNOT00000003091
Ensembl Acc Id:
ENSRNOP00000064143 ⟸ ENSRNOT00000072527
RefSeq Acc Id:
NP_001389157 ⟸ NM_001402228
- UniProtKB:
D3ZQV8 (UniProtKB/TrEMBL), A6KUK6 (UniProtKB/TrEMBL), M0R464 (UniProtKB/TrEMBL)
RGD ID: 13702072 Promoter ID: EPDNEW_R12590 Type: multiple initiation site Name: LOC103690175_1 Description: PHD finger protein 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 158,739,815 - 158,739,875 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Phf6
PHD finger protein 6
LOC103690175
PHD finger protein 6
Data merged from RGD:9471618
737654 PROVISIONAL
2014-08-25
LOC103690175
PHD finger protein 6
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-07-24
Phf6
PHD finger protein 6
LOC100359714
PHD finger protein 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-05-06
LOC100359714
PHD finger protein 6
Symbol and Name status set to provisional
70820 PROVISIONAL
