Symbol:
Cartpt
Name:
CART prepropeptide
RGD ID:
2272
Description:
Predicted to enable neuropeptide hormone activity. Involved in several processes, including adult feeding behavior; circadian regulation of gene expression; and regulation of peptide hormone secretion. Located in extracellular space. Used to study cerebral infarction. Biomarker of amphetamine abuse; cognitive disorder (multiple); morphine dependence; obesity; and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in alcohol dependence; alcohol use disorder; and obesity. Orthologous to human CARTPT (CART prepropeptide); INTERACTS WITH (3,4-dihydroxyphenyl)acetic acid; (S)-nicotine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Cart; cocaine and amphetamine regulated transcript; cocaine- and amphetamine-regulated transcript protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CARTPT (CART prepropeptide) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cartpt (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cartpt (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CARTPT (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CARTPT (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cartpt (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CARTPT (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CARTPT (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cartpt (CART prepropeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CHMP7 (charged multivesicular body protein 7) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Cartpt (CART prepropeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CARTPT (CART prepropeptide)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cart2 (cocaine- and amphetamine-regulated transcript 2)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cartpt
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 32,989,215 - 32,991,794 (-) NCBI GRCr8 mRatBN7.2 2 31,255,098 - 31,257,452 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 31,255,098 - 31,290,713 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 38,333,324 - 38,335,346 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 36,427,667 - 36,429,691 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 31,220,463 - 31,222,481 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 30,125,249 - 30,127,408 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 30,125,249 - 30,127,269 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 49,285,118 - 49,287,405 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 30,889,817 - 30,891,837 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 30,810,185 - 30,812,206 (-) NCBI Celera 2 27,276,402 - 27,278,422 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cartpt Rat (3,4-dihydroxyphenyl)acetic acid increases abundance EXP 6480464 CARTPT protein results in increased abundance of 3 and 4-Dihydroxyphenylacetic Acid CTD PMID:15659233 Cartpt Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of CARTPT protein CTD PMID:23623838 Cartpt Rat (S)-nicotine decreases expression ISO CARTPT (Homo sapiens) 6480464 Nicotine results in decreased expression of CARTPT mRNA CTD PMID:18247414 Cartpt Rat 1,2-dimethylhydrazine increases expression ISO Cartpt (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CARTPT mRNA CTD PMID:22206623 Cartpt Rat 17alpha-ethynylestradiol multiple interactions ISO Cartpt (Mus musculus) 6480464 ESR1 gene mutant form inhibits the reaction [Ethinyl Estradiol results in decreased expression of CARTPT mRNA] CTD PMID:29112739 Cartpt Rat 17alpha-ethynylestradiol decreases expression ISO Cartpt (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of CARTPT mRNA CTD PMID:29112739 Cartpt Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CARTPT mRNA CTD PMID:20068009 Cartpt Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Cartpt (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cartpt Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO Cartpt (Mus musculus) 6480464 2 more ... CTD PMID:29112739 Cartpt Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Cartpt (Mus musculus) 6480464 ESR1 gene mutant form inhibits the reaction [2 more ... CTD PMID:29112739 Cartpt Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Cartpt (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cartpt Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with LEP protein] affects the expression of CARTPT mRNA CTD PMID:15977195 Cartpt Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CARTPT mRNA CTD PMID:15093705 Cartpt Rat 2-naphthylamine increases expression ISO CARTPT (Homo sapiens) 6480464 2-Naphthylamine results in increased expression of CARTPT mRNA CTD PMID:18247414 Cartpt Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions EXP 6480464 bisindolylmaleimide I inhibits the reaction [CARTPT protein results in increased phosphorylation of GRIN1 protein] CTD PMID:19632277 Cartpt Rat 4,4'-sulfonyldiphenol decreases expression ISO Cartpt (Mus musculus) 6480464 bisphenol S results in decreased expression of CARTPT mRNA CTD PMID:30951980 Cartpt Rat 4,4'-sulfonyldiphenol increases expression ISO Cartpt (Mus musculus) 6480464 bisphenol S results in increased expression of CARTPT protein CTD PMID:37675141 Cartpt Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CARTPT mRNA CTD PMID:24780913 Cartpt Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CARTPT mRNA CTD PMID:28959563 Cartpt Rat acrylamide decreases expression ISO Cartpt (Mus musculus) 6480464 Acrylamide results in decreased expression of CARTPT mRNA CTD PMID:35032568 Cartpt Rat alpha-melanocyte stimulating hormone multiple interactions EXP 6480464 alpha-MSH binds to and results in increased activity of CARTPT protein CTD PMID:15659233 Cartpt Rat AM-251 increases expression EXP 6480464 AM 251 results in increased expression of CARTPT mRNA CTD PMID:26468265 Cartpt Rat AM-251 multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride and Dietary deficiency] results in increased expression of CARTPT mRNA CTD PMID:26468265 Cartpt Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CARTPT mRNA CTD PMID:16483693 Cartpt Rat amphetamine multiple interactions EXP 6480464 NPY mutant form promotes the reaction [Amphetamine results in increased expression of CARTPT mRNA] more ... CTD PMID:25825358 Cartpt Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CARTPT mRNA and Amphetamine results in increased expression of CARTPT protein CTD PMID:16896163 and PMID:25825358 Cartpt Rat arachidonyl-2'-chloroethylamide decreases expression EXP 6480464 arachidonyl-2-chloroethylamide results in decreased expression of CARTPT mRNA CTD PMID:26468265 Cartpt Rat arachidonyl-2'-chloroethylamide multiple interactions EXP 6480464 [arachidonyl-2-chloroethylamide co-treated with Water deficiency co-treated with Sodium Chloride and Dietary deficiency] results in increased expression of CARTPT mRNA CTD PMID:26468265 Cartpt Rat arsenite(3-) increases methylation ISO CARTPT (Homo sapiens) 6480464 arsenite results in increased methylation of CARTPT promoter CTD PMID:23974009 Cartpt Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CARTPT gene CTD PMID:28931070 Cartpt Rat benzene increases expression ISO Cartpt (Mus musculus) 6480464 Benzene results in increased expression of CARTPT mRNA CTD PMID:37084897 Cartpt Rat benzo[a]pyrene increases expression ISO CARTPT (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CARTPT mRNA CTD PMID:18247414 Cartpt Rat benzo[a]pyrene decreases methylation ISO CARTPT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CARTPT exon CTD PMID:27901495 Cartpt Rat benzo[a]pyrene affects methylation ISO CARTPT (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CARTPT promoter CTD PMID:27901495 Cartpt Rat benzo[a]pyrene decreases expression ISO Cartpt (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CARTPT mRNA CTD PMID:22228805 and PMID:23735875 Cartpt Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of CARTPT mRNA CTD PMID:21839799 Cartpt Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CARTPT mRNA CTD PMID:25181051 and PMID:34947998 Cartpt Rat bisphenol A increases expression ISO Cartpt (Mus musculus) 6480464 bisphenol A results in increased expression of CARTPT mRNA and bisphenol A results in increased expression of CARTPT protein CTD PMID:27641926 and PMID:37675141 Cartpt Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CARTPT gene CTD PMID:28505145 Cartpt Rat Butylparaben multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in increased expression of CARTPT mRNA CTD PMID:34383603 Cartpt Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of CARTPT mRNA CTD PMID:19167457 Cartpt Rat carbonyl sulfide decreases expression EXP 6480464 carbonyl sulfide results in decreased expression of CARTPT mRNA CTD PMID:19395590 Cartpt Rat CGP 52608 multiple interactions ISO CARTPT (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CART gene] CTD PMID:28238834 Cartpt Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of CARTPT mRNA CTD PMID:18668222 Cartpt Rat chlorpyrifos multiple interactions ISO CARTPT (Homo sapiens) 6480464 [APOE gene polymorphism affects the susceptibility to Chlorpyrifos] which affects the expression of CARTPT mRNA CTD PMID:31472362 Cartpt Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of CARTPT mRNA CTD PMID:14696011 Cartpt Rat cocaine increases expression ISO CARTPT (Homo sapiens) 6480464 Cocaine results in increased expression of CARTPT mRNA CTD PMID:15009677 Cartpt Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of CARTPT mRNA CTD PMID:17851536 and PMID:20187946 Cartpt Rat copper atom multiple interactions ISO Cartpt (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of CARTPT mRNA CTD PMID:15467011 Cartpt Rat copper(0) multiple interactions ISO Cartpt (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of CARTPT mRNA CTD PMID:15467011 Cartpt Rat corticosterone increases abundance EXP 6480464 CARTPT protein results in increased abundance of Corticosterone CTD PMID:15271883 Cartpt Rat corticosterone multiple interactions EXP 6480464 astressin B inhibits the reaction [CARTPT protein results in increased abundance of Corticosterone] CTD PMID:15271883 Cartpt Rat DDE multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in increased expression of CARTPT mRNA CTD PMID:34383603 Cartpt Rat dichlorine decreases expression EXP 6480464 Chlorine results in decreased expression of CARTPT mRNA CTD PMID:18636392 Cartpt Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of CARTPT mRNA CTD PMID:18636392 Cartpt Rat diprotium oxide multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride more ... CTD PMID:26468265 Cartpt Rat entinostat decreases expression ISO CARTPT (Homo sapiens) 6480464 entinostat results in decreased expression of CARTPT mRNA CTD PMID:27188386 Cartpt Rat enzacamene multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in increased expression of CARTPT mRNA CTD PMID:34383603 Cartpt Rat ethanol increases response to substance ISO Cartpt (Mus musculus) 6480464 CARTPT gene mutant form results in increased susceptibility to Ethanol CTD PMID:22823101 Cartpt Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of CARTPT protein CTD PMID:21167239 Cartpt Rat fonofos increases methylation ISO CARTPT (Homo sapiens) 6480464 Fonofos results in increased methylation of CARTPT promoter CTD PMID:22847954 Cartpt Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of CARTPT mRNA CTD PMID:37121297 Cartpt Rat Glutathione ethyl ester multiple interactions EXP 6480464 S-ethyl glutathione inhibits the reaction [Amphetamine results in decreased expression of CARTPT protein] and S-ethyl glutathione inhibits the reaction [Amphetamine results in increased expression of CARTPT mRNA] CTD PMID:25825358 Cartpt Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of CARTPT mRNA CTD PMID:24915197 Cartpt Rat hydrogen sulfide increases expression ISO Cartpt (Mus musculus) 6480464 Hydrogen Sulfide results in increased expression of CARTPT mRNA CTD PMID:31843631 Cartpt Rat icariin increases expression ISO Cartpt (Mus musculus) 6480464 icariin results in increased expression of CARTPT mRNA and icariin results in increased expression of CARTPT protein CTD PMID:19858766 Cartpt Rat KT 5720 multiple interactions EXP 6480464 KT 5720 inhibits the reaction [CARTPT protein results in increased phosphorylation of GRIN1 protein] CTD PMID:19632277 Cartpt Rat linuron multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in increased expression of CARTPT mRNA CTD PMID:34383603 Cartpt Rat lipopolysaccharide affects localization EXP 6480464 Lipopolysaccharides affects the localization of CARTPT protein CTD PMID:12559087 Cartpt Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of CARTPT protein CTD PMID:12559087 Cartpt Rat malathion increases expression ISO CARTPT (Homo sapiens) 6480464 Malathion results in increased expression of CARTPT mRNA CTD PMID:37047231 Cartpt Rat methylmercury chloride increases expression ISO CARTPT (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CARTPT mRNA CTD PMID:34089799 Cartpt Rat morphine increases expression ISO Cartpt (Mus musculus) 6480464 Morphine results in increased expression of CARTPT mRNA CTD PMID:20144693 Cartpt Rat morphine hydrochloride decreases expression EXP 407571681 morphine hydrochloride decreases expression of Cartpt mRNA in hippocampus RGD Cartpt Rat nicotine decreases expression ISO CARTPT (Homo sapiens) 6480464 Nicotine results in decreased expression of CARTPT mRNA CTD PMID:18247414 Cartpt Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of CARTPT protein CTD PMID:23623838 Cartpt Rat nitroprusside multiple interactions EXP 6480464 Nitroprusside affects the cleavage of and affects the expression of CARTPT protein CTD PMID:12588509 Cartpt Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of CARTPT mRNA CTD PMID:18636392 Cartpt Rat paracetamol multiple interactions EXP 6480464 [Plasticizers co-treated with Fungicides and Industrial co-treated with Linuron co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with Dichlorodiphenyl Dichloroethylene co-treated with butylparaben co-treated with Acetaminophen] results in increased expression of CARTPT mRNA CTD PMID:34383603 Cartpt Rat parathion increases methylation ISO CARTPT (Homo sapiens) 6480464 Parathion results in increased methylation of CARTPT promoter CTD PMID:22847954 Cartpt Rat PCB138 multiple interactions ISO Cartpt (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Cartpt Rat pirinixic acid multiple interactions ISO Cartpt (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of CARTPT mRNA CTD PMID:20813756 Cartpt Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of CARTPT mRNA CTD PMID:19162173 Cartpt Rat pirinixic acid increases expression ISO Cartpt (Mus musculus) 6480464 pirinixic acid results in increased expression of CARTPT mRNA CTD PMID:20813756 Cartpt Rat rimonabant multiple interactions ISO Cartpt (Mus musculus) 6480464 FAAH affects the reaction [Rimonabant affects the expression of CARTPT protein] CTD PMID:16131814 Cartpt Rat rimonabant affects expression ISO Cartpt (Mus musculus) 6480464 Rimonabant affects the expression of CARTPT protein CTD PMID:16131814 Cartpt Rat rimonabant increases response to substance ISO Cartpt (Mus musculus) 6480464 CARTPT results in increased susceptibility to Rimonabant CTD PMID:16131814 Cartpt Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of CARTPT mRNA CTD PMID:19013527 Cartpt Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of CARTPT mRNA CTD PMID:17540011 Cartpt Rat Soman increases expression EXP 6480464 Soman results in increased expression of CARTPT mRNA CTD PMID:19281266 Cartpt Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of CARTPT mRNA CTD PMID:20219977 Cartpt Rat streptozocin multiple interactions EXP 6480464 GHRL protein promotes the reaction [Streptozocin results in decreased expression of CARTPT mRNA] CTD PMID:20219977 Cartpt Rat terbufos increases methylation ISO CARTPT (Homo sapiens) 6480464 terbufos results in increased methylation of CARTPT promoter CTD PMID:22847954 Cartpt Rat titanium dioxide decreases methylation ISO Cartpt (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CARTPT gene CTD PMID:35295148 Cartpt Rat triphenyl phosphate multiple interactions ISO Cartpt (Mus musculus) 6480464 [tris(1 more ... CTD PMID:29112739 Cartpt Rat water multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride more ... CTD PMID:26468265
(3,4-dihydroxyphenyl)acetic acid (EXP) (S)-nicotine (EXP,ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-naphthylamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) alpha-melanocyte stimulating hormone (EXP) AM-251 (EXP) ammonium chloride (EXP) amphetamine (EXP) arachidonyl-2'-chloroethylamide (EXP) arsenite(3-) (ISO) atrazine (EXP) benzene (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) Butylparaben (EXP) C60 fullerene (EXP) carbonyl sulfide (EXP) CGP 52608 (ISO) chlorpyrifos (EXP,ISO) clozapine (EXP) cocaine (EXP,ISO) copper atom (ISO) copper(0) (ISO) corticosterone (EXP) DDE (EXP) dichlorine (EXP) diprotium oxide (EXP) entinostat (ISO) enzacamene (EXP) ethanol (ISO) fluoxetine (EXP) fonofos (ISO) fructose (EXP) Glutathione ethyl ester (EXP) glycidol (EXP) hydrogen sulfide (ISO) icariin (ISO) KT 5720 (EXP) linuron (EXP) lipopolysaccharide (EXP) malathion (ISO) methylmercury chloride (ISO) morphine (ISO) morphine hydrochloride (EXP) nicotine (EXP,ISO) nitroprusside (EXP) ozone (EXP) paracetamol (EXP) parathion (ISO) PCB138 (ISO) pirinixic acid (EXP,ISO) rimonabant (ISO) rotenone (EXP) scopolamine (EXP) Soman (EXP) streptozocin (EXP) terbufos (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) water (EXP)
Biological Process
adult feeding behavior (IDA,IEA,ISO) behavioral response to cocaine (IDA) cAMP biosynthetic process (IDA) cellular response to estradiol stimulus (IEP) cellular response to starvation (IBA,IDA,IEA,ISO) chemical synaptic transmission (IEA) circadian regulation of gene expression (IDA) circadian rhythm (IEP) conditioned place preference (IDA) detection of chemical stimulus involved in sensory perception of pain (IDA) detection of temperature stimulus involved in sensory perception of pain (IDA) drinking behavior (IDA) G protein-coupled receptor signaling pathway (IDA,IEA,ISO) gastric acid secretion (TAS) glucose metabolic process (IDA) intracellular calcium ion homeostasis (IDA) intracellular glucose homeostasis (IEA,ISO,ISS) negative regulation of appetite (IBA,IDA,IEA,ISO) negative regulation of bone resorption (IEA,ISO) negative regulation of cytosolic calcium ion concentration (IDA) negative regulation of D-glucose import (IDA) negative regulation of eating behavior (IMP) negative regulation of glucagon secretion (IDA) negative regulation of locomotion (IDA) negative regulation of relaxation of smooth muscle (IDA) negative regulation of type B pancreatic cell apoptotic process (IDA) neuropeptide signaling pathway (IEA) operant conditioning (IDA,IMP) positive regulation of blood pressure (IEA,ISO,ISS) positive regulation of epinephrine secretion (IEA,ISO,ISS) positive regulation of exocytosis (IMP) positive regulation of insulin secretion involved in cellular response to glucose stimulus (IDA,IMP) positive regulation of MAPK cascade (IDA,IEA,ISO) positive regulation of protein kinase activity (ISO) positive regulation of transmission of nerve impulse (IEA,ISO,ISS) positive regulation of type B pancreatic cell proliferation (IDA) regulation of bone remodeling (IEA,ISO) regulation of circadian sleep/wake cycle, non-REM sleep (IDA) regulation of circadian sleep/wake cycle, REM sleep (IDA) regulation of circadian sleep/wake cycle, wakefulness (IDA) regulation of exocytosis (IDA) regulation of heart rate by chemical signal (IDA) regulation of insulin secretion (IDA) regulation of lipid biosynthetic process (IDA) regulation of lipid catabolic process (IDA) regulation of locomotion involved in locomotory behavior (IDA) regulation of systemic arterial blood pressure by neurotransmitter (IDA) response to corticosterone (IEP) response to corticotropin-releasing hormone (IEP) response to ethanol (IEP) response to food (IEP) response to glucocorticoid (IEP) response to glucose (IEP) response to insulin (IEP) response to morphine (IEP) response to starvation (IEP) somatostatin secretion (IDA)
1.
CART is overexpressed in human type 2 diabetic islets and inhibits glucagon secretion and increases insulin secretion.
Abels M, etal., Diabetologia. 2016 Sep;59(9):1928-37. doi: 10.1007/s00125-016-4020-6. Epub 2016 Jun 23.
2.
Gene expression profile of the nucleus accumbens of human cocaine abusers: evidence for dysregulation of myelin.
Albertson DN, etal., J Neurochem. 2004 Mar;88(5):1211-9. doi: 10.1046/j.1471-4159.2003.02247.x.
3.
Evaluation of the CART peptide expression in morphine sensitization in male rats.
Bakhtazad A, etal., Eur J Pharmacol. 2017 May 5;802:52-59. doi: 10.1016/j.ejphar.2017.02.040. Epub 2017 Feb 24.
4.
CART peptide and opioid addiction: Expression changes in male rat brain.
Bakhtazad A, etal., Neuroscience. 2016 Jun 14;325:63-73. doi: 10.1016/j.neuroscience.2016.02.071. Epub 2016 Mar 5.
5.
The effect of microinjection of CART 55-102 into the nucleus accumbens shell on morphine-induced conditioned place preference in rats: Involvement of the NMDA receptor.
Bakhtazad A, etal., Peptides. 2020 Jul;129:170319. doi: 10.1016/j.peptides.2020.170319. Epub 2020 Apr 23.
6.
Effects of adrenalectomy on CART expression in the rat arcuate nucleus.
Balkan B, etal., Synapse. 2003 Oct;50(1):14-9. doi: 10.1002/syn.10213.
7.
Cocaine- and amphetamine-regulated transcript is expressed in adipocytes and regulate lipid- and glucose homeostasis.
Banke E, etal., Regul Pept. 2013 Mar 10;182:35-40. doi: 10.1016/j.regpep.2012.12.011. Epub 2013 Jan 11.
8.
Early and transient ontogenetic expression of the cocaine- and amphetamine-regulated transcript peptide in the rat mesencephalon: correlation with tyrosine hydroxylase expression.
Brischoux F, etal., J Neurobiol 2002 Sep 5;52(3):221-9.
9.
Cocaine and amphetamine regulated transcript (CART) gene in the comorbidity of schizophrenia with alcohol use disorders and nicotine dependence.
Busto A, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2010 Aug 16;34(6):834-6. doi: 10.1016/j.pnpbp.2010.03.030. Epub 2010 Mar 30.
10.
Production of recombinant CART peptides in Escherichia coli with agonist and antagonist effects on food intake in rats.
Couceyro PR and Fritz T, Protein Expr Purif. 2003 Dec;32(2):185-93. doi: 10.1016/j.pep.2003.08.015.
11.
Antinociceptive effects of supraspinal rat cart (55-102) peptide in mice.
Damaj MI, etal., Brain Res. 2003 Sep 5;983(1-2):233-6. doi: 10.1016/s0006-8993(03)03094-4.
12.
Maternal ethanol exposure reshapes CART system in the rat brain: Correlation with development of anxiety, depression and memory deficits.
Dandekar MP, etal., Neuroscience. 2019 May 15;406:126-139. doi: 10.1016/j.neuroscience.2019.02.010. Epub 2019 Feb 28.
13.
Mutational screening of the CART gene in obese children: identifying a mutation (Leu34Phe) associated with reduced resting energy expenditure and cosegregating with obesity phenotype in a large family.
del Giudice EM, etal., Diabetes. 2001 Sep;50(9):2157-60.
14.
PCR differential display identifies a rat brain mRNA that is transcriptionally regulated by cocaine and amphetamine.
Douglass J, etal., J Neurosci 1995 Mar;15(3 Pt 2):2471-81.
15.
Expression and activity of cocaine- and amphetamine-regulated transcript peptide(1-39) in the rat.
Dun SL, etal., Regul Pept. 2007 Apr 5;140(1-2):47-54. doi: 10.1016/j.regpep.2006.11.010. Epub 2006 Dec 21.
16.
Sequence variants in the human cocaine and amphetamine-regulated transcript (CART) gene in subjects with early onset obesity.
Echwald SM, etal., Obes Res. 1999 Nov;7(6):532-6.
17.
Cocaine- and amphetamine-regulated transcript: distribution and function in rat gastrointestinal tract.
Ekblad E, etal., Neurogastroenterol Motil. 2003 Oct;15(5):545-57. doi: 10.1046/j.1365-2982.2003.00437.x.
18.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
19.
Colocalization of CART peptide with prodynorphin and dopamine D1 receptors in the rat nucleus accumbens.
Hubert GW and Kuhar MJ, Neuropeptides. 2006 Dec;40(6):409-15. Epub 2006 Oct 24.
20.
Cocaine-and-Amphetamine Regulated Transcript (CART) peptide attenuates dopamine- and cocaine-mediated locomotor activity in both male and female rats: lack of sex differences.
Job MO, etal., Neuropeptides. 2014 Apr;48(2):75-81. doi: 10.1016/j.npep.2014.01.002. Epub 2014 Jan 10.
21.
Association between polymorphism in intron 1 of cocaine- and amphetamine-regulated transcript gene with alcoholism, but not with bipolar disorder and schizophrenia in Korean population.
Jung SK, etal., Neurosci Lett. 2004 Jul 15;365(1):54-7. doi: 10.1016/j.neulet.2004.04.036.
22.
Wake promoting effects of cocaine and amphetamine-regulated transcript (CART).
Keating GL, etal., Neuropeptides. 2010 Jun;44(3):241-6. doi: 10.1016/j.npep.2009.12.013. Epub 2010 Feb 8.
23.
CART peptide 55-102 microinjected into the nucleus accumbens inhibits the expression of behavioral sensitization by amphetamine.
Kim S, etal., Regul Pept. 2007 Dec 4;144(1-3):6-9. doi: 10.1016/j.regpep.2007.07.003. Epub 2007 Jul 17.
24.
Compulsive methamphetamine taking in the presence of punishment is associated with increased oxytocin expression in the nucleus accumbens of rats.
Krasnova IN, etal., Sci Rep. 2017 Aug 21;7(1):8331. doi: 10.1038/s41598-017-08898-8.
25.
Hypothalamic CART is a new anorectic peptide regulated by leptin.
Kristensen P, etal., Nature. 1998 May 7;393(6680):72-6.
26.
Cocaine- and amphetamine-regulated transcript (CART) peptide activates the extracellular signal-regulated kinase (ERK) pathway in AtT20 cells via putative G-protein coupled receptors.
Lakatos A, etal., Neurosci Lett. 2005 Aug 12-19;384(1-2):198-202.
27.
Blunted Vagal Cocaine- and Amphetamine-Regulated Transcript Promotes Hyperphagia and Weight Gain.
Lee SJ, etal., Cell Rep. 2020 Feb 11;30(6):2028-2039.e4. doi: 10.1016/j.celrep.2020.01.045.
28.
Altered R-spondin 1/CART neurocircuit in the hypothalamus contributes to hyperphagia in diabetes.
Li JY, etal., J Neurophysiol. 2019 Mar 1;121(3):928-939. doi: 10.1152/jn.00413.2018. Epub 2019 Jan 16.
29.
Traumatic stress affects alcohol‑drinking behavior through cocaine‑ and amphetamine‑regulated transcript 55‑102 in the paraventricular nucleus in rats.
Liu J, etal., Mol Med Rep. 2018 Jan;17(1):1157-1165. doi: 10.3892/mmr.2017.7989. Epub 2017 Nov 6.
30.
The neuroprotective effect of NeuroAid on morphine-induced amnesia with respect to the expression of TFAM, PGC-1α, ΔfosB and CART genes in the hippocampus of male Wistar rats.
Malboosi N, etal., Gene. 2020 Jun 5;742:144601. doi: 10.1016/j.gene.2020.144601. Epub 2020 Mar 19.
31.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
32.
Cocaine- and amphetamine-regulated transcript in the nucleus accumbens shell attenuates context-induced reinstatement of alcohol seeking.
Millan EZ and McNally GP, Behav Neurosci. 2012 Oct;126(5):690-8. doi: 10.1037/a0029953.
33.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
34.
Cocaine-amphetamine-regulated transcript (CART) acts in the central nervous system to inhibit gastric acid secretion via brain corticotropin-releasing factor system.
Okumura T, etal., Endocrinology 2000 Aug;141(8):2854-60.
35.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
36.
A cocaine-and-amphetamine-regulated-transcript peptide projection from the lateral hypothalamus to the ventral tegmental area.
Philpot KB, etal., Neuroscience. 2005;135(3):915-25. doi: 10.1016/j.neuroscience.2005.06.064. Epub 2005 Sep 8.
37.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
38.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
39.
Ethanol enhancement of cocaine- and amphetamine-regulated transcript mRNA and peptide expression in the nucleus accumbens.
Salinas A, etal., J Neurochem. 2006 Apr;97(2):408-15. doi: 10.1111/j.1471-4159.2006.03745.x. Epub 2006 Mar 15.
40.
Cocaine- and amphetamine-regulated transcript (CART) protects beta cells against glucotoxicity and increases cell proliferation.
Sathanoori R, etal., J Biol Chem. 2013 Feb 1;288(5):3208-18. doi: 10.1074/jbc.M112.437145. Epub 2012 Dec 16.
41.
Endogenous beta-cell CART regulates insulin secretion and transcription of beta-cell genes.
Shcherbina L, etal., Mol Cell Endocrinol. 2017 May 15;447:52-60. doi: 10.1016/j.mce.2017.02.027. Epub 2017 Feb 24.
42.
Testosterone (T)-induced changes in arcuate nucleus cocaine-amphetamine-regulated transcript and NPY mRNA are attenuated in old compared to young male brown Norway rats: contribution of T to age-related changes in cocaine-amphetamine-regulated transcript and NPY gene expression.
Sohn EH, etal., Endocrinology 2002 Mar;143(3):954-63.
43.
Regulation of rat pituitary cocaine- and amphetamine-regulated transcript (CART) by CRH and glucocorticoids.
Stanley SA, etal., Am J Physiol Endocrinol Metab. 2004 Sep;287(3):E583-90. doi: 10.1152/ajpendo.00576.2003. Epub 2004 May 11.
44.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
45.
CART peptide diurnal rhythm in brain and effect of fasting.
Vicentic A, etal., Brain Res. 2005 Jan 25;1032(1-2):111-5.
46.
Effect of corticosterone on CART peptide levels in rat blood.
Vicentic A, etal., Peptides. 2005 Mar;26(3):531-3. doi: 10.1016/j.peptides.2004.10.023.
47.
A polymorphism in the gene encoding CART is not associated with obesity in Pima Indians.
Walder K, etal., Int J Obes Relat Metab Disord. 2000 Apr;24(4):520-1.
48.
Cocaine and amphetamine regulated transcript (CART) signalling in the central nucleus of the amygdala modulates stress-induced alcohol seeking.
Walker LC, etal., Neuropsychopharmacology. 2021 Jan;46(2):325-333. doi: 10.1038/s41386-020-00807-4. Epub 2020 Aug 21.
49.
CART regulates islet hormone secretion and is expressed in the beta-cells of type 2 diabetic rats.
Wierup N, etal., Diabetes. 2006 Feb;55(2):305-11.
50.
Role of cocaine- and amphetamine-regulated transcript in estradiol-mediated neuroprotection.
Xu Y, etal., Proc Natl Acad Sci U S A. 2006 Sep 26;103(39):14489-94. doi: 10.1073/pnas.0602932103. Epub 2006 Sep 13.
51.
Cocaine- and amphetamine-regulated transcript peptide modulation of voltage-gated Ca2+ signaling in hippocampal neurons.
Yermolaieva O, etal., J Neurosci. 2001 Oct 1;21(19):7474-80. doi: 10.1523/JNEUROSCI.21-19-07474.2001.
Cartpt Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 32,989,215 - 32,991,794 (-) NCBI GRCr8 mRatBN7.2 2 31,255,098 - 31,257,452 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 31,255,098 - 31,290,713 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 38,333,324 - 38,335,346 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 36,427,667 - 36,429,691 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 31,220,463 - 31,222,481 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 30,125,249 - 30,127,408 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 30,125,249 - 30,127,269 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 49,285,118 - 49,287,405 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 30,889,817 - 30,891,837 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 30,810,185 - 30,812,206 (-) NCBI Celera 2 27,276,402 - 27,278,422 (-) NCBI Celera Cytogenetic Map 2 q12 NCBI
CARTPT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 71,719,275 - 71,721,045 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 71,719,275 - 71,721,048 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 71,015,102 - 71,016,872 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 71,050,750 - 71,052,628 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 66,910,678 - 66,912,563 (+) NCBI Celera Cytogenetic Map 5 q13.2 NCBI HuRef 5 66,220,931 - 66,222,816 (+) NCBI HuRef CHM1_1 5 70,447,686 - 70,449,571 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 72,200,597 - 72,202,367 (+) NCBI T2T-CHM13v2.0
Cartpt Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 100,034,991 - 100,037,191 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 100,034,997 - 100,037,599 (-) Ensembl GRCm39 Ensembl GRCm38 13 99,898,483 - 99,910,179 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 99,898,489 - 99,901,091 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 100,668,439 - 100,670,638 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 100,998,914 - 101,000,892 (-) NCBI MGSCv36 mm8 Celera 13 103,550,272 - 103,552,922 (-) NCBI Celera Cytogenetic Map 13 D1 NCBI cM Map 13 52.9 NCBI
Cartpt Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955575 551,991 - 555,149 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955575 551,991 - 555,118 (+) NCBI ChiLan1.0 ChiLan1.0
CARTPT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 43,593,184 - 43,595,366 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 41,746,812 - 41,748,989 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 43,591,683 - 43,593,586 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 44,236,114 - 44,238,229 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 44,236,114 - 44,238,229 (-) Ensembl panpan1.1 panPan2
CARTPT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 54,865,043 - 54,867,410 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 54,865,298 - 54,867,158 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 51,831,747 - 51,833,904 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 55,380,658 - 55,382,812 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 55,380,662 - 55,382,560 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 52,441,398 - 52,443,555 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 53,208,304 - 53,210,460 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 54,099,675 - 54,101,833 (+) NCBI UU_Cfam_GSD_1.0
Cartpt Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 186,139,406 - 186,141,636 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936549 4,717,771 - 4,719,395 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936549 4,717,337 - 4,719,523 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CARTPT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 48,043,492 - 48,045,592 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 48,043,558 - 48,045,592 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 51,989,808 - 51,991,843 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CARTPT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 66,058,755 - 66,060,635 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 66,058,769 - 66,061,112 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 14,805,312 - 14,807,192 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cartpt
.
Predicted Target Of
Count of predictions: 173 Count of miRNA genes: 134 Interacting mature miRNAs: 143 Transcripts: ENSRNOT00000023869 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 631682 Bp115 Blood pressure QTL 115 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 1 37410502 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 738010 Lnnr3 Liver neoplastic nodule remodeling QTL 3 2.94 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 2 1 41244106 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 1331764 Bp205 Blood pressure QTL 205 3.476 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 26999571 43154682 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1600379 Mcs18 Mammary carcinoma susceptibility QTL 18 2.6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 7887772 42804738 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
1
16
107
36
33
6
10
6
1
66
40
92
10
26
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023869 ⟹ ENSRNOP00000023869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 31,255,098 - 31,290,713 (-) Ensembl Rnor_6.0 Ensembl 2 30,125,249 - 30,127,269 (-) Ensembl
RefSeq Acc Id:
NM_017110 ⟹ NP_058806
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 32,989,215 - 32,991,235 (-) NCBI mRatBN7.2 2 31,255,098 - 31,257,120 (-) NCBI Rnor_6.0 2 30,125,249 - 30,127,269 (-) NCBI Rnor_5.0 2 49,285,118 - 49,287,405 (-) NCBI RGSC_v3.4 2 30,889,817 - 30,891,837 (-) RGD Celera 2 27,276,402 - 27,278,422 (-) RGD
Sequence:
AGCGAGGAAGTCCAGCACCATGGAGAGCTCCCGCCTGCGGCTGCTACCCGTCCTGGGCGCCGCCCTACTGCTGCTGCTACCTTTGCTGGGTGCCGGTGCCCAGGAGGATGCCGAGCTGCAGCCCCGAG
hide sequence
RefSeq Acc Id:
XM_006231843 ⟹ XP_006231905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 32,989,474 - 32,991,794 (-) NCBI mRatBN7.2 2 31,255,099 - 31,257,452 (-) NCBI Rnor_6.0 2 30,125,252 - 30,127,408 (-) NCBI Rnor_5.0 2 49,285,118 - 49,287,405 (-) NCBI
Sequence:
CGTCAAACGGCAGCGGAGCGCTGCCTACAGACGGCTGACCCGGGCTCTTCTCCACACCCCCGTCCTTCTTCTCCCCCTCCCTTTTCCCGGCACCCGATTTCAACCGGCTATAAGAAGAGGGAGAGCGC
hide sequence
RefSeq Acc Id:
NP_058806 ⟸ NM_017110
- Peptide Label:
precursor
- UniProtKB:
P49192 (UniProtKB/Swiss-Prot), A6I575 (UniProtKB/TrEMBL)
- Sequence:
MESSRLRLLPVLGAALLLLLPLLGAGAQEDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKC
hide sequence
RefSeq Acc Id:
XP_006231905 ⟸ XM_006231843
- Peptide Label:
isoform X1
- UniProtKB:
P49192 (UniProtKB/Swiss-Prot)
- Sequence:
MESSRLRLLPVLGAALLLLLPLLGAGAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKL
hide sequence
Ensembl Acc Id:
ENSRNOP00000023869 ⟸ ENSRNOT00000023869
RGD ID: 13691099 Promoter ID: EPDNEW_R1624 Type: single initiation site Name: Cartpt_1 Description: CART prepropeptide SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 30,127,269 - 30,127,329 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-15
Cartpt
CART prepropeptide
Cart
cocaine and amphetamine regulated transcript
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Cart
cocaine and amphetamine regulated transcript
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in mesencephalon of central nervous system
634696
gene_process
may have a role in the development of specific regions of the rat brain
634696
gene_regulation
expression may be regulated by testosterone
1299848
