Advanced Search (OLGA)

Gene: Adat3 (adenosine deaminase, tRNA-specific 3) Rattus norvegicus

Analyze

Symbol:

Adat3

Name:

adenosine deaminase, tRNA-specific 3

RGD ID:

1642417

Description:

Predicted to enable catalytic activity and metal ion binding activity. Predicted to be involved in tRNA processing. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in neurodevelopmental disorder with brain abnormalities, poor growth, and dysmorphic facies. Orthologous to human ADAT3 (adenosine deaminase tRNA specific 3); INTERACTS WITH acrylamide; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adenosine deaminase, tRNA-specific 3, TAD3 homolog; adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae); MGC112753; probable inactive tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine-34 deaminase subunit ADAT3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADAT3 (adenosine deaminase tRNA specific 3)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Adat3 (adenosine deaminase, tRNA-specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adat3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADAT3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Adat3 (adenosine deaminase tRNA specific 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ADAT3 (adenosine deaminase tRNA specific 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ADAT3 (adenosine deaminase tRNA specific 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adat3 (adenosine deaminase, tRNA-specific 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adat3 (adenosine deaminase tRNA specific 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10927	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TAD3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TAD3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y47D3A.14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	minpp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	9,758,671 - 9,764,582 (-)	Ensembl				GRCr8
mRatBN7.2	7	9,109,070 - 9,113,673 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,987,333 - 11,988,702 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,862,845 - 13,864,214 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,728,888 - 11,730,257 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,977,285 - 11,981,814 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	7,291,257 - 7,292,626 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

neurodevelopmental disorder with brain abnormalities, poor growth, and dysmorphic facies (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

cadmium dichloride (EXP)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

DDE (ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

disodium selenite (ISO)

ethanol (ISO)

Licochalcone B (ISO)

methotrexate (ISO)

paracetamol (ISO)

resveratrol (ISO)

rotenone (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

toluene (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

tRNA processing (IEA)

Cellular Component

cytoplasm (IBA,IEA)

nucleus (IBA,IEA)

Molecular Function

catalytic activity (IEA)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:15632090

Genomics

Comparative Map Data

Adat3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	9,758,671 - 9,764,582 (-)	Ensembl				GRCr8
mRatBN7.2	7	9,109,070 - 9,113,673 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	11,987,333 - 11,988,702 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	13,862,845 - 13,864,214 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	11,728,888 - 11,730,257 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	11,977,285 - 11,981,814 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	7,291,257 - 7,292,626 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

ADAT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	1,905,399 - 1,913,447 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	1,905,399 - 1,913,447 (+)	Ensembl			hg38	GRCh38
GRCh37	19	1,905,398 - 1,913,446 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	1,856,417 - 1,864,446 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	19	1,839,500 - 1,847,520 (+)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	1,676,853 - 1,684,944 (+)	NCBI		HuRef
CHM1_1	19	1,904,960 - 1,913,035 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	1,876,716 - 1,884,760 (+)	NCBI		T2T-CHM13v2.0

Adat3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	80,438,714 - 80,443,488 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	80,438,714 - 80,443,488 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm39 Ensembl	10	80,441,855 - 80,451,618 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	80,602,880 - 80,607,654 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	80,606,021 - 80,615,784 (+)	Ensembl			mm10	GRCm38
GRCm38.p6 Ensembl	10	80,602,880 - 80,607,654 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	80,065,625 - 80,070,399 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
Celera	10	81,620,704 - 81,625,478 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

ADAT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	6,276,650 - 6,284,607 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	5,507,422 - 5,515,555 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	910,954 - 912,687 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	1,890,221 - 1,892,044 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	1,890,437 - 1,891,748 (+)	Ensembl			panPan2	panpan1.1

ADAT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,062,706 - 57,065,492 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	56,856,950 - 56,861,365 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	57,794,907 - 57,799,327 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	20	56,851,736 - 56,856,137 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	57,331,731 - 57,336,147 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	57,532,745 - 57,537,165 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Adat3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	216,723,639 - 216,730,690 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936588	1,108,790 - 1,111,287 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADAT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	76,628,633 - 76,634,262 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	76,628,626 - 76,634,282 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	77,333,682 - 77,339,154 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADAT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	1,695,897 - 1,705,718 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666081	7,082,891 - 7,090,329 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adat3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	154,279,685 - 154,284,492 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Adat3
7 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1669658	46669658	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	1	23748937	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	7216097	52216097	Rat
2290372	Gluco33	Glucose level QTL 33	2.71		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	1	31777942	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1709527	46709527	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	32612984	Rat
1582260	Bw72	Body weight QTL 72	3.2	0.0043	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582261	Bw69	Body weight QTL 69	3.2	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
1582262	Bw75	Body weight QTL 75	3	0.0038	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	39960528	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	9460877	54460877	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	29716167	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34650782	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	32612984	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	sensory system	visual system
7	1	17	48	67	137	94	11	47	36	32	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001103361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC093394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000095368 ⟹ ENSRNOP00000089590

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	9,758,671 - 9,761,114 (-)	Ensembl
mRatBN7.2 Ensembl	7	9,101,187 - 9,115,340 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106355 ⟹ ENSRNOP00000077221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	9,759,048 - 9,761,297 (-)	Ensembl
mRatBN7.2 Ensembl	7	9,101,502 - 9,114,507 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000125787 ⟹ ENSRNOP00000103572

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	9,759,046 - 9,764,582 (-)	Ensembl

RefSeq Acc Id:

NM_001103361 ⟹ NP_001096831

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	9,759,758 - 9,761,127 (-)	NCBI
mRatBN7.2	7	9,109,073 - 9,110,442 (-)	NCBI
Rnor_6.0	7	11,977,285 - 11,978,654 (-)	NCBI
Rnor_5.0	7	12,144,810 - 12,146,179 (-)	NCBI
RGSC_v3.4	7	10,619,919 - 10,621,288 (-)	RGD
Celera	7	7,291,257 - 7,292,626 (-)	RGD

Sequence:

show sequence

CTGTCTCCCACAGTCGAGCCCCGCTGAGGATGGAGCCCACCTCAGGCTTTGCAGAGCAACCTGG
GCCTGAGAAGGTTGAAAGTGAGGAGCAAGAGCCGGCGCAGTGGCAAGCCCTCCCTGTCCTGTCG
GAGCAGCAGTCGGGGGCCGTGGAGCTGGTACTGGCCTACGCTGCACCTGTCCTGGACAAGCGCC
AGACGTCCCGCCTCCTCCGGGAGGTGTCTGCTGTCTATCCACTTCCTGCCCAGCCCCACCTCAA
ACGGGTGCGCCCCAGCCGCAGTGCAGGCGGTGCGCACTCGTCGGATCTGCTGTTGTGCCTGGCC
GGGCCGTCCGCGGGCCCGCGCTCGCTGGCCGAGCTCCTTCCGAGGCCGGCCGTGGACCCGCGCG
GCCTGGGCACACCTTTCTTGGTGCCTGTGCCTGCCCGGCCGCCCCTTACCCGGAGCCAGTTTGA
GGAGGCGCGGGCCCACTGGCCCACATCCTTCCATGAAGACAAGCAGGTGACCAGTGCTTTGGCC
GGGCAACTCTTCTCTGCGCAGGCTCGAGCCGCCATGCAGACCCACATGGAACGGGCAGTACGTG
CGGCCCAGAGGGCAGCCGCGCAGGGGCTGCGGGCAGTGGGTGCCGTCGTGGTGGACCCAGCCTC
GGACCATGTGTTGGCCACAGGCCATGACTGCTGCAGCGAAGCCAGCCCCTTGCTGCACGCCGTC
ATGGTATGCATCGACCTGGTGGCCCAGGGGCAGGGCCGAGGCTCCTGCGACCTCAGACGCCACC
CAGCTTGCTCCTTCACACAGGCCACTGCCACTCAGAGCGCCCGTGCTGGTAGCGTGCGCAAGCT
GGACGAAGATAGCCTGCCCTATGTGTGCACCGGTTATGACCTGTACGTCACCCGAGAGCCCTGT
GTCATGTGCGCCATGGCCCTCGTCCACGCCCGTATCCAGCGTGTCTTCTATGGGGCGCCCTCAC
CCGATGGCGCCTTGGGCACGCGCTTCCGTGTCCACGCTCGGCCAGACCTCAACCACCGCTTCCA
GGTGTTCCGCGGCATCCTCGAGGACCAGTGCCGCCAGCTGGACCCCGACCCGTAGGCCTCGTGA
CCTTCTGCTTCTAGACCATTCTCTGCTCCTGGCCAGCCCGCATCCCCTGCAGCTCCATGGCCTT
GGGCCTGGGGTCCCGCCCTCTGTGTCTGAGGACACTGACCACCTGTGCCAGACTGTGGGCCTCT
CAGTTTCGAGACTGCAGCTTCTCTGGTGGCTGCGACACCGTGGGGCTCTGCTCTGCTTGCAAGC
CCAGTGGCTGCCTTAGAGTCCCCGTGGTGGTCCTCTAGGCTCGGGGCAGGGAGCAGCCATCGAG
TGTGAAAATAAAGCACCTCAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001096831	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93394	(Get FASTA)	NCBI Sequence Viewer
	EDL89262	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000089590
	ENSRNOP00000089590.1
GenBank Protein	Q561R2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001096831 ⟸ NM_001103361

- UniProtKB:

Q561R2 (UniProtKB/Swiss-Prot), A6K8J2 (UniProtKB/TrEMBL), A0A8I5XVX2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPTSGFAEQPGPEKVESEEQEPAQWQALPVLSEQQSGAVELVLAYAAPVLDKRQTSRLLREVS
AVYPLPAQPHLKRVRPSRSAGGAHSSDLLLCLAGPSAGPRSLAELLPRPAVDPRGLGTPFLVPV
PARPPLTRSQFEEARAHWPTSFHEDKQVTSALAGQLFSAQARAAMQTHMERAVRAAQRAAAQGL
RAVGAVVVDPASDHVLATGHDCCSEASPLLHAVMVCIDLVAQGQGRGSCDLRRHPACSFTQATA
TQSARAGSVRKLDEDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGALGTRFR
VHARPDLNHRFQVFRGILEDQCRQLDPDP

hide sequence

Ensembl Acc Id:

ENSRNOP00000089590 ⟸ ENSRNOT00000095368

Ensembl Acc Id:

ENSRNOP00000077221 ⟸ ENSRNOT00000106355

Ensembl Acc Id:

ENSRNOP00000103572 ⟸ ENSRNOT00000125787

Protein Domains

CMP/dCMP-type deaminase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q561R2-F1-model_v2	AlphaFold	Q561R2	1-349	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1642417	AgrOrtholog
BioCyc Gene	G2FUF-34954	BioCyc
Ensembl Genes	ENSRNOG00000063591	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000095368	ENTREZGENE
	ENSRNOT00000095368.1	UniProtKB/Swiss-Prot
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7388692	IMAGE-MGC_LOAD
InterPro	CMP_dCMP_dom	UniProtKB/Swiss-Prot
	Cytidine_deaminase-like	UniProtKB/Swiss-Prot
KEGG Report	rno:100125374	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112753	IMAGE-MGC_LOAD
NCBI Gene	100125374	ENTREZGENE
PANTHER	CYTOSINE DEAMINASE FAMILY MEMBER	UniProtKB/Swiss-Prot
	INACTIVE TRNA-SPECIFIC ADENOSINE DEAMINASE-LIKE PROTEIN 3-RELATED	UniProtKB/Swiss-Prot
Pfam	dCMP_cyt_deam_1	UniProtKB/Swiss-Prot
PhenoGen	Adat3	PhenoGen
PROSITE	CYT_DCMP_DEAMINASES_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000063591	RatGTEx
Superfamily-SCOP	SSF53927	UniProtKB/Swiss-Prot
UniProt	A0A8I5XVX2	ENTREZGENE, UniProtKB/TrEMBL
	A6K8J2	ENTREZGENE, UniProtKB/TrEMBL
	ADAT3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-28	Adat3	adenosine deaminase, tRNA-specific 3	Adat3	adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Adat3	adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)	Adat3	adenosine deaminase, tRNA-specific 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-09-15	Adat3	adenosine deaminase, tRNA-specific 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - OMIM