Advanced Search (OLGA)

Gene: Srp9 (signal recognition particle 9) Rattus norvegicus

Analyze

Symbol:

Srp9

Name:

signal recognition particle 9

RGD ID:

1597343

Description:

Predicted to enable 7S RNA binding activity. Predicted to be involved in SRP-dependent cotranslational protein targeting to membrane. Predicted to be located in cytosol. Predicted to be part of signal recognition particle, endoplasmic reticulum targeting. Orthologous to human SRP9 (signal recognition particle 9); PARTICIPATES IN interleukin-3 signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC690345; signal recognition particle 9 kDa protein; similar to Signal recognition particle 9 kDa protein (SRP9)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SRP9 (signal recognition particle 9)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Srp9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Srp9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SRP9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SRP9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Srp9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SRP9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SRP9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Srp9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Srp9 (signal recognition particle 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	INSIG2 (insulin induced gene 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SRP9 (signal recognition particle 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SRP9 (signal recognition particle 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Srp9 (signal recognition particle 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	srp9 (signal recognition particle 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ZK512.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Srp9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	srp9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	96,364,253 - 96,372,393 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	96,364,298 - 96,373,257 (+)	Ensembl				GRCr8
mRatBN7.2	13	93,832,580 - 93,840,720 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	93,832,580 - 93,840,720 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	96,337,864 - 96,346,004 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	97,737,747 - 97,745,887 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	94,919,927 - 94,928,067 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	100,551,307 - 100,559,447 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	100,551,307 - 100,559,447 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	105,486,289 - 105,494,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	98,125,510 - 98,133,650 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	93,365,993 - 93,374,180 (+)	NCBI		Celera
Cytogenetic Map	13	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (EXP,ISO)

Butylbenzyl phthalate (ISO)

caffeine (ISO)

calyculin A (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorohydrocarbon (EXP)

chloropicrin (ISO)

chrysene (ISO)

cisplatin (ISO)

clotrimazole (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

erianin (ISO)

ethanol (ISO)

ferroheme b (ISO)

folic acid (ISO)

fonofos (ISO)

glafenine (EXP)

gold atom (ISO)

gold(0) (ISO)

heme b (ISO)

hydralazine (ISO)

indometacin (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

nicotine (ISO)

ozone (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

terbufos (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of translational elongation (IEA)

SRP-dependent cotranslational protein targeting to membrane (IBA,IEA)

Cellular Component

cytoplasm (IEA)

cytosol (IEA)

ribonucleoprotein complex (IEA)

signal recognition particle (IEA)

signal recognition particle, endoplasmic reticulum targeting (IBA,IEA)

Molecular Function

7S RNA binding (IEA)

protein binding (ISO)

RNA binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-3 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Srp9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	96,364,253 - 96,372,393 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	96,364,298 - 96,373,257 (+)	Ensembl				GRCr8
mRatBN7.2	13	93,832,580 - 93,840,720 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	93,832,580 - 93,840,720 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	96,337,864 - 96,346,004 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	97,737,747 - 97,745,887 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	94,919,927 - 94,928,067 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	100,551,307 - 100,559,447 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	100,551,307 - 100,559,447 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	105,486,289 - 105,494,429 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	98,125,510 - 98,133,650 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	93,365,993 - 93,374,180 (+)	NCBI		Celera
Cytogenetic Map	13	q26	NCBI

SRP9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	225,777,826 - 225,790,464 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	225,777,699 - 225,790,670 (+)	Ensembl			hg38	GRCh38
GRCh37	1	225,965,528 - 225,978,166 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	224,032,154 - 224,044,787 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	222,272,273 - 222,284,896	NCBI
Celera	1	199,156,523 - 199,169,222 (+)	NCBI		Celera
Cytogenetic Map	1	q42.12	NCBI
HuRef	1	196,483,476 - 196,496,108 (+)	NCBI		HuRef
CHM1_1	1	227,237,869 - 227,250,522 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	224,965,843 - 224,978,462 (+)	NCBI		T2T-CHM13v2.0

Srp9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	181,952,302 - 181,959,980 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	181,952,302 - 181,959,972 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	182,124,737 - 182,132,415 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	182,124,737 - 182,132,407 (+)	Ensembl			mm10	GRCm38
MGSCv37	1	184,054,868 - 184,062,546 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	183,961,425 - 183,969,063 (+)	NCBI		MGSCv36	mm8
Celera	1	189,181,350 - 189,188,997 (+)	NCBI		Celera
Cytogenetic Map	1	H5	NCBI
cM Map	1	84.93	NCBI

Srp9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955520	159,331 - 168,507 (-)	Ensembl
ChiLan1.0	NW_004955520	163,713 - 168,507 (-)	NCBI	ChiLan1.0	ChiLan1.0

SRP9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	23,747,333 - 23,760,035 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	23,695,708 - 23,708,401 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	201,238,977 - 201,251,606 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	206,240,484 - 206,252,854 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	206,240,484 - 206,252,854 (+)	Ensembl			panPan2	panpan1.1

SRP9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	39,012,142 - 39,023,009 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	39,013,806 - 39,022,991 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	38,494,353 - 38,505,218 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	38,846,134 - 38,857,000 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	7	38,685,853 - 38,696,724 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	38,694,000 - 38,704,877 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	38,963,819 - 38,974,690 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Srp9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	52,152,196 - 52,163,296 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936526	2,583,836 - 2,595,777 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936526	2,583,986 - 2,595,105 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SRP9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	13,672,355 - 13,723,800 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	13,711,538 - 13,723,806 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	16,065,547 - 16,077,814 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SRP9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666055	3,979,556 - 3,993,001 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Srp9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624835	6,206,298 - 6,212,807 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624835	6,205,686 - 6,211,962 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Srp9
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	60,445,822 - 60,453,525 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Srp9
46 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	87
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000004297
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

RH130766

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	93,840,304 - 93,840,489 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	100,559,032 - 100,559,216	NCBI	Rnor6.0
Rnor_5.0	13	105,494,014 - 105,494,198	UniSTS	Rnor5.0
RGSC_v3.4	13	98,133,235 - 98,133,419	UniSTS	RGSC3.4
Celera	13	93,373,765 - 93,373,949	UniSTS
RH 3.4 Map	13	632.8	UniSTS
Cytogenetic Map	13	q26	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001126095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004297 ⟹ ENSRNOP00000004297

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	96,364,298 - 96,373,257 (+)	Ensembl
mRatBN7.2 Ensembl	13	93,832,580 - 93,840,720 (+)	Ensembl
Rnor_6.0 Ensembl	13	100,551,307 - 100,559,447 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094961 ⟹ ENSRNOP00000092364

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	93,832,653 - 93,840,168 (+)	Ensembl

RefSeq Acc Id:

NM_001126095 ⟹ NP_001119567

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	96,364,253 - 96,372,393 (+)	NCBI
mRatBN7.2	13	93,832,580 - 93,840,720 (+)	NCBI
Rnor_6.0	13	100,551,307 - 100,559,447 (+)	NCBI
Rnor_5.0	13	105,486,289 - 105,494,429 (+)	NCBI
RGSC_v3.4	13	98,125,510 - 98,133,650 (+)	RGD
Celera	13	93,365,993 - 93,374,180 (+)	RGD

Sequence:

show sequence

GCCGGGGCTGACCAATGGCGCAAGCGCTAGTGCGCCTCCATCTTTGGGCCGCCAGAGTCCAGCG
CTGTGGGCGGTTGCGGGAGAGCGGTGGGCTGTCAGTGCGACAGCGCGTTTCTTGCTTCGCGGCC
TCGTTTCGCGCTGCCCGAAGCCGCGATGCCTCAGTTCCAGACCTGGGAGGAGTTCAGCCGCGCG
GCTGAGAAGCTCTACTTGGCGGACCCCATGAAGGTACGTGTGGTTCTCAAGTACAGGCATGTTG
ATGGGAATTTGTGTATCAAAGTGACGGACGATCTAGTCTGTTTGGTGTACAGAACAGACCAAGC
TCAAGATGTAAAGAAGATTGAGAAATTCCACAGTCAGTTAATGCGACTTATGGTGGCCAAGGAA
TCCCGCAGTGTCGCTATGGAAACAGAATGAATGGTTTGAAATGAAGACTGTTATGTTCTTGGGA
AGTAAACAGCTTTTGAAACTGAGAAAGTGTTGGGACGGAAATATTTATATAACGGAGCTGTGGA
AAGCTGGGAGACCAGCCTGTGTCCTAAGGTTTGTTTAGAGAGTAGGAATGTCAGGGTTTTCAGT
TAGAAAACCTTTATTTTTGGAAACTGAATAAGGGATATCTTAAAACTTTTTGCTGATAATTTGA
TGTTGGACAAATATATAGTTATTTTTTTCTGGTAAATTCATATCAGTAACTTGTTGAAGAATTG
ACAAGAAAAGTTCTTTCTAGATTGTGTTTAAGAGGAAATAAAATGTAACTTTTGCTGTGTTGGT
ATGTGTCTTTTGAAGTGTGACATATATCCGTTTCTAATAAACACGGGATAACTGGGATCACCCG
CTCTGCGGTGCCGATCCGTCTGGTGTGTGAAGAGCAAGTCTCTACCTTTCTTGCCAGGTTCAAA
CCGTTTCCAATGGATGCTTGCTGAGCCATGAGTGACTTGAAGTCTGGCTTTTAGTGACCCGAGC
CAGATGCCAGTTCTGAGTGCACAGGCAGGGTGACGACGCCGATGACTGGGCGGCATGTGTGCAG
AGCACTGGCAGTGTAGCTCCCACTCAGACTGAGTGAAGTATTAGCACAGCATGCCTCTCAGAAC
CCTTAGGTTCCTAATGAACCAGAAGCCCACCGTTCATGTGTAGCTGGTGTTTGTGAAACGCTTT
ACCATCTAAAGGTGATGTTCCGTGCTGTCTGCTCAGGACTGAAGGGAAGGGGCCACATTAAAGT
AGTCTTTGTAAAAGTTGTCATGTTGAATAACTTGAAATTTTTATTAGTTATAAGAACTCTAGTC
TGCTTTAGAGAGGTCAGTAAATAAAATATAAGCATACTATTTTTGTTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001119567	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94865	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004297
	ENSRNOP00000004297.2

RefSeq Acc Id:	NP_001119567 ⟸ NM_001126095
- UniProtKB:	D4A511 (UniProtKB/TrEMBL), A6JGK9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEK FHSQLMRLMVAKESRSVAMETE hide sequence

Ensembl Acc Id:

ENSRNOP00000004297 ⟸ ENSRNOT00000004297

Ensembl Acc Id:

ENSRNOP00000092364 ⟸ ENSRNOT00000094961

Protein Domains

SRP9

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A511-F1-model_v2	AlphaFold	D4A511	1-86	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699075

Promoter ID:

EPDNEW_R9600

Type:

initiation region

Name:

Srp9_1

Description:

signal recognition particle 9

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	100,551,352 - 100,551,412	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1597343	AgrOrtholog
BioCyc Gene	G2FUF-17087	BioCyc
Ensembl Genes	ENSRNOG00000003211	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004297	ENTREZGENE
	ENSRNOT00000004297.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.720.10	UniProtKB/TrEMBL
InterPro	Signal_recog_particle_SRP9	UniProtKB/TrEMBL
	Signal_recog_particle_SRP9/14	UniProtKB/TrEMBL
	SRP9/Srp21	UniProtKB/TrEMBL
	SRP9_dom	UniProtKB/TrEMBL
KEGG Report	rno:690345	UniProtKB/TrEMBL
NCBI Gene	690345	ENTREZGENE
PANTHER	PTHR12834	UniProtKB/TrEMBL
	SIGNAL RECOGNITION PARTICLE 9 KDA PROTEIN	UniProtKB/TrEMBL
Pfam	SRP9-21	UniProtKB/TrEMBL
PhenoGen	Srp9	PhenoGen
PIRSF	Signal_recog_particle_SRP9	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003211	RatGTEx
Superfamily-SCOP	SRP9/14	UniProtKB/TrEMBL
UniProt	A6JGK9	ENTREZGENE, UniProtKB/TrEMBL
	D4A511	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-07-08	Srp9	signal recognition particle 9	LOC682826	similar to Signal recognition particle 9 kDa protein (SRP9)	Data merged from RGD:1594021	1643240	APPROVED
2008-03-06	Srp9	signal recognition particle 9	LOC690345	similar to Signal recognition particle 9 kDa protein (SRP9)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC690345	similar to Signal recognition particle 9 kDa protein (SRP9)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC682826	similar to Signal recognition particle 9 kDa protein (SRP9)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - PID (archival)