Symbol:
Crip1
Name:
cysteine rich protein 1
RGD ID:
1597237
Description:
Predicted to enable peptide binding activity and zinc ion binding activity. Predicted to be involved in several processes, including cellular response to UV-B; intrinsic apoptotic signaling pathway in response to DNA damage; and prostate gland stromal morphogenesis. Predicted to be located in cytoplasm. Orthologous to human CRIP1 (cysteine rich protein 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
CRIP; Crp-1; cysteine-rich intestinal protein; cysteine-rich protein 1; cysteine-rich protein 1 (intestinal); LOC691657; RATCRIP; similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CRIP1 (cysteine rich protein 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Crip1 (cysteine-rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Crip1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CRIP1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CRIP1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Crip1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LOC110258364 (cysteine-rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CRIP1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Crip1 (cysteine rich protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CRIP1 (cysteine rich protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Crip1 (cysteine-rich protein 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
crip1 (cysteine-rich protein 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
exc-9
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
valv-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
crip1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 138,047,801 - 138,055,672 (+) NCBI GRCr8 mRatBN7.2 6 132,226,746 - 132,234,620 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 132,226,746 - 132,234,620 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 132,395,928 - 132,403,668 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 132,686,073 - 132,693,813 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 132,061,146 - 132,069,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 137,959,171 - 137,967,042 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 137,959,171 - 137,967,042 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 146,953,514 - 146,961,385 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 138,156,366 - 138,161,127 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 138,162,743 - 138,165,342 (+) NCBI Celera 6 129,765,196 - 129,773,068 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Crip1 Rat (1->4)-beta-D-glucan multiple interactions ISO Crip1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CRIP1 mRNA CTD PMID:36331819 Crip1 Rat 1,1-dichloroethene increases expression ISO Crip1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of CRIP1 mRNA CTD PMID:26682919 Crip1 Rat 1,2-dimethylhydrazine decreases expression ISO Crip1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CRIP1 mRNA CTD PMID:22206623 Crip1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CRIP mRNA CTD PMID:25380136 Crip1 Rat 17alpha-ethynylestradiol increases expression ISO Crip1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CRIP1 mRNA CTD PMID:17942748 Crip1 Rat 17alpha-ethynylestradiol multiple interactions ISO Crip1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CRIP1 mRNA CTD PMID:17942748 Crip1 Rat 17alpha-ethynylestradiol affects expression ISO Crip1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CRIP1 mRNA CTD PMID:17555576 Crip1 Rat 17beta-estradiol affects expression ISO CRIP1 (Homo sapiens) 6480464 Estradiol affects the expression of CRIP1 mRNA CTD PMID:14699072 Crip1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of CRIP1 mRNA CTD PMID:32145629 Crip1 Rat 17beta-estradiol multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of CRIP1 mRNA CTD PMID:30165855 Crip1 Rat 17beta-estradiol increases expression ISO Crip1 (Mus musculus) 6480464 Estradiol results in increased expression of CRIP1 mRNA CTD PMID:19484750 Crip1 Rat 17beta-estradiol decreases expression ISO CRIP1 (Homo sapiens) 6480464 Estradiol results in decreased expression of CRIP1 mRNA CTD PMID:23019147 and PMID:31614463 Crip1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Crip1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CRIP1 mRNA CTD PMID:17942748 Crip1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRIP1 mRNA CTD PMID:33387578 Crip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CRIP1 mRNA CTD PMID:34747641 Crip1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CRIP1 mRNA CTD PMID:32109520 Crip1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CRIP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CRIP1 mRNA CTD PMID:20106945 and PMID:21632981 Crip1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Crip1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Crip1 Rat 2-butoxyethanol decreases expression ISO Crip1 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of CRIP1 mRNA CTD PMID:19812364 Crip1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CRIP mRNA CTD PMID:25380136 Crip1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Crip1 (Mus musculus) 6480464 Fenretinide results in decreased expression of CRIP1 mRNA CTD PMID:28973697 Crip1 Rat 4-hydroxyphenyl retinamide increases expression ISO Crip1 (Mus musculus) 6480464 Fenretinide results in increased expression of CRIP1 mRNA CTD PMID:28973697 Crip1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CRIP1 mRNA CTD PMID:22504374 and PMID:30047161 Crip1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of CRIP mRNA CTD PMID:24780913 Crip1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CRIP1 mRNA CTD PMID:31881176 Crip1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CRIP1 mRNA CTD PMID:35163327 Crip1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CRIP1 mRNA CTD PMID:30047161 Crip1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CRIP1 mRNA CTD PMID:16483693 Crip1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CRIP1 mRNA CTD PMID:30779732 Crip1 Rat aristolochic acid A increases expression ISO CRIP1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CRIP1 mRNA CTD PMID:33212167 Crip1 Rat arsane multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRIP1 mRNA CTD PMID:32525701 Crip1 Rat arsenic atom multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRIP1 mRNA CTD PMID:32525701 Crip1 Rat arsenite(3-) affects expression ISO CRIP1 (Homo sapiens) 6480464 arsenite affects the expression of CRIP1 mRNA CTD PMID:22959463 Crip1 Rat arsenous acid multiple interactions ISO CRIP1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CRIP1 protein] CTD PMID:26598702 Crip1 Rat atrazine multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Atrazine co-treated with Arsenates] results in increased expression of CRIP1 mRNA CTD PMID:18585445 Crip1 Rat belinostat multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRIP1 mRNA CTD PMID:27188386 Crip1 Rat belinostat increases expression ISO CRIP1 (Homo sapiens) 6480464 belinostat results in increased expression of CRIP1 mRNA CTD PMID:26272509 Crip1 Rat benzo[a]pyrene affects methylation ISO CRIP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CRIP1 promoter CTD PMID:27901495 Crip1 Rat benzo[a]pyrene increases methylation ISO CRIP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CRIP1 5' UTR and Benzo(a)pyrene results in increased methylation of CRIP1 exon CTD PMID:27901495 Crip1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CRIP1 mRNA CTD PMID:25181051 and PMID:32145629 Crip1 Rat bisphenol A increases expression ISO Crip1 (Mus musculus) 6480464 bisphenol A results in increased expression of CRIP1 mRNA CTD PMID:32156529 Crip1 Rat bisphenol A decreases expression ISO Crip1 (Mus musculus) 6480464 bisphenol A results in decreased expression of CRIP1 mRNA CTD PMID:35598803 Crip1 Rat bisphenol A increases expression ISO CRIP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CRIP1 protein CTD PMID:37567409 Crip1 Rat bisphenol A decreases expression ISO CRIP1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CRIP1 mRNA CTD PMID:31715268 Crip1 Rat bisphenol A affects expression ISO CRIP1 (Homo sapiens) 6480464 bisphenol A affects the expression of CRIP1 mRNA CTD PMID:30903817 Crip1 Rat bisphenol F increases expression ISO CRIP1 (Homo sapiens) 6480464 bisphenol F results in increased expression of CRIP1 mRNA CTD PMID:33476716 Crip1 Rat cadmium dichloride decreases expression ISO CRIP1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CRIP1 mRNA CTD PMID:38382870 Crip1 Rat carbon nanotube decreases expression ISO Crip1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Crip1 Rat choline multiple interactions ISO Crip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CRIP1 mRNA CTD PMID:20938992 Crip1 Rat cisplatin increases expression ISO CRIP1 (Homo sapiens) 6480464 Cisplatin results in increased expression of CRIP1 mRNA CTD PMID:27392435 and PMID:27594783 Crip1 Rat cisplatin multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of CRIP1 mRNA CTD PMID:27392435 Crip1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CRIP1 mRNA CTD PMID:24386269 Crip1 Rat copper(II) sulfate decreases expression ISO CRIP1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CRIP1 mRNA CTD PMID:19549813 Crip1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CRIP1 mRNA CTD PMID:26577399 Crip1 Rat cyclosporin A decreases expression ISO CRIP1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CRIP1 mRNA CTD PMID:25562108 Crip1 Rat diarsenic trioxide multiple interactions ISO CRIP1 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CRIP1 protein] CTD PMID:26598702 Crip1 Rat Dibutyl phosphate affects expression ISO CRIP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of CRIP1 mRNA CTD PMID:37042841 Crip1 Rat dioxygen multiple interactions ISO Crip1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CRIP1 mRNA CTD PMID:30529165 Crip1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CRIP mRNA CTD PMID:25152437 Crip1 Rat dorsomorphin multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Crip1 Rat entinostat increases expression ISO CRIP1 (Homo sapiens) 6480464 entinostat results in increased expression of CRIP1 mRNA CTD PMID:26272509 and PMID:27188386 Crip1 Rat entinostat multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRIP1 mRNA CTD PMID:27188386 Crip1 Rat fluoranthene multiple interactions ISO Crip1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of CRIP1 mRNA CTD PMID:28329830 Crip1 Rat folic acid multiple interactions ISO Crip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CRIP1 mRNA CTD PMID:20938992 Crip1 Rat genistein increases expression ISO CRIP1 (Homo sapiens) 6480464 Genistein results in increased expression of CRIP1 protein CTD PMID:20884965 Crip1 Rat genistein multiple interactions ISO CRIP1 (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in increased expression of CRIP1 protein] CTD PMID:20884965 Crip1 Rat hydrogen peroxide affects expression ISO CRIP1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CRIP1 mRNA CTD PMID:20044591 Crip1 Rat ivermectin decreases expression ISO CRIP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CRIP1 protein CTD PMID:32959892 Crip1 Rat L-methionine multiple interactions ISO Crip1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CRIP1 mRNA CTD PMID:20938992 Crip1 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of CRIP mRNA CTD PMID:24136188 Crip1 Rat lithium atom increases expression ISO CRIP1 (Homo sapiens) 6480464 Lithium results in increased expression of CRIP1 mRNA CTD PMID:21092101 Crip1 Rat lithium hydride increases expression ISO CRIP1 (Homo sapiens) 6480464 Lithium results in increased expression of CRIP1 mRNA CTD PMID:21092101 Crip1 Rat menadione affects expression ISO CRIP1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of CRIP1 mRNA CTD PMID:20044591 Crip1 Rat mercury atom decreases expression ISO Crip1 (Mus musculus) 6480464 Mercury analog results in decreased expression of CRIP1 mRNA CTD PMID:25056781 Crip1 Rat mercury(0) decreases expression ISO Crip1 (Mus musculus) 6480464 Mercury analog results in decreased expression of CRIP1 mRNA CTD PMID:25056781 Crip1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of CRIP1 mRNA CTD PMID:22504374 and PMID:30047161 Crip1 Rat methylmercury chloride decreases expression ISO CRIP1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of CRIP1 mRNA CTD PMID:28001369 Crip1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of CRIP mRNA CTD PMID:25380136 Crip1 Rat nitrates multiple interactions ISO Crip1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CRIP1 mRNA CTD PMID:35964746 Crip1 Rat ozone multiple interactions ISO Crip1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CRIP1 mRNA CTD PMID:34911549 Crip1 Rat panobinostat multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRIP1 mRNA CTD PMID:27188386 Crip1 Rat paracetamol affects expression ISO Crip1 (Mus musculus) 6480464 Acetaminophen affects the expression of CRIP1 mRNA CTD PMID:17562736 Crip1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CRIP1 mRNA CTD PMID:33387578 Crip1 Rat paricalcitol multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of CRIP1 mRNA CTD PMID:17715259 Crip1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Crip1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CRIP1 mRNA CTD PMID:36331819 Crip1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CRIP1 mRNA CTD PMID:35163327 Crip1 Rat phosphorus atom multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of CRIP1 mRNA CTD PMID:17715259 Crip1 Rat phosphorus(.) multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of CRIP1 mRNA CTD PMID:17715259 Crip1 Rat pirinixic acid multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of CRIP1 mRNA CTD PMID:19710929 Crip1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of CRIP1 mRNA CTD PMID:30047161 Crip1 Rat progesterone decreases expression ISO CRIP1 (Homo sapiens) 6480464 Progesterone results in decreased expression of CRIP1 mRNA CTD PMID:21540246 Crip1 Rat resveratrol decreases expression ISO CRIP1 (Homo sapiens) 6480464 resveratrol results in decreased expression of CRIP1 mRNA CTD PMID:19371625 Crip1 Rat resveratrol increases expression ISO CRIP1 (Homo sapiens) 6480464 resveratrol results in increased expression of CRIP1 protein CTD PMID:18089832 Crip1 Rat SB 431542 multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Crip1 Rat senecionine decreases expression ISO Crip1 (Mus musculus) 6480464 senecionine results in decreased expression of CRIP1 protein CTD PMID:35357534 Crip1 Rat sodium arsenate multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of CRIP1 mRNA CTD PMID:32525701 Crip1 Rat sodium arsenite decreases expression ISO Crip1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CRIP1 mRNA CTD PMID:33933676 Crip1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of CRIP1 mRNA CTD PMID:30047161 Crip1 Rat sunitinib decreases expression ISO CRIP1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of CRIP1 mRNA CTD PMID:31533062 Crip1 Rat tamoxifen affects expression ISO Crip1 (Mus musculus) 6480464 Tamoxifen affects the expression of CRIP1 mRNA CTD PMID:17555576 Crip1 Rat tert-butyl hydroperoxide increases expression ISO Crip1 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of CRIP1 mRNA CTD PMID:15003993 Crip1 Rat tetrachloromethane increases expression ISO Crip1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CRIP1 mRNA CTD PMID:17484886 more ... Crip1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CRIP1 mRNA CTD PMID:33387578 Crip1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CRIP1 mRNA CTD PMID:34492290 Crip1 Rat titanium dioxide increases expression ISO Crip1 (Mus musculus) 6480464 titanium dioxide results in increased expression of CRIP1 mRNA CTD PMID:23557971 Crip1 Rat tributylstannane increases expression ISO Crip1 (Mus musculus) 6480464 tributyltin results in increased expression of CRIP1 mRNA CTD PMID:31939706 Crip1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of CRIP1 mRNA CTD PMID:33387578 Crip1 Rat trichostatin A increases expression ISO CRIP1 (Homo sapiens) 6480464 trichostatin A results in increased expression of CRIP1 mRNA CTD PMID:24935251 and PMID:26272509 Crip1 Rat trichostatin A multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRIP1 mRNA CTD PMID:27188386 Crip1 Rat triclosan decreases expression ISO CRIP1 (Homo sapiens) 6480464 Triclosan results in decreased expression of CRIP1 mRNA CTD PMID:30510588 Crip1 Rat tungsten increases expression ISO Crip1 (Mus musculus) 6480464 Tungsten results in increased expression of CRIP1 mRNA CTD PMID:30912803 Crip1 Rat valproic acid increases expression ISO Crip1 (Mus musculus) 6480464 Valproic Acid results in increased expression of CRIP1 mRNA CTD PMID:21427059 Crip1 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CRIP1 mRNA CTD PMID:35594946 Crip1 Rat valproic acid increases expression ISO CRIP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CRIP1 mRNA CTD PMID:23179753 more ... Crip1 Rat valproic acid multiple interactions ISO CRIP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CRIP1 mRNA CTD PMID:27188386 Crip1 Rat valproic acid increases methylation ISO CRIP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CRIP1 gene CTD PMID:29154799 Crip1 Rat valproic acid affects expression ISO CRIP1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CRIP1 mRNA CTD PMID:25979313 Crip1 Rat vancomycin decreases expression ISO Crip1 (Mus musculus) 6480464 Vancomycin results in decreased expression of CRIP1 mRNA CTD PMID:18930951 Crip1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CRIP1 mRNA CTD PMID:19015723 Crip1 Rat vorinostat increases expression ISO CRIP1 (Homo sapiens) 6480464 vorinostat results in increased expression of CRIP1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 4,4'-diaminodiphenylmethane (EXP) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) entinostat (ISO) fluoranthene (ISO) folic acid (ISO) genistein (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (EXP) lithium atom (ISO) lithium hydride (ISO) menadione (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methylmercury chloride (ISO) N-nitrosodimethylamine (EXP) nitrates (ISO) ozone (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paricalcitol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phosphorus atom (ISO) phosphorus(.) (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) resveratrol (ISO) SB 431542 (ISO) senecionine (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) tungsten (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
DNA bending by the mammalian high-mobility group protein AT hook 2.
Chen B, etal., Biochemistry. 2010 Mar 2;49(8):1590-5. doi: 10.1021/bi901881c.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Identification and rational redesign of peptide ligands to CRIP1, a novel biomarker for cancers.
Hao J, etal., PLoS Comput Biol. 2008 Aug 1;4(8):e1000138. doi: 10.1371/journal.pcbi.1000138.
4.
Human cysteine-rich intestinal protein: cDNA cloning and expression of recombinant protein and identification in human peripheral blood mononuclear cells.
Khoo C, etal., Protein Expr Purif. 1997 Apr;9(3):379-87.
5.
Ultraviolet B radiation regulates cysteine-rich protein 1 in human keratinocytes.
Latonen L, etal., Photodermatol Photoimmunol Photomed. 2010 Apr;26(2):70-7. doi: 10.1111/j.1600-0781.2010.00488.x.
6.
Cloning and initial characterization of the promoter region of the rat cysteine-rich intestinal protein gene.
Levenson CW, etal., Biochem J 1994 Nov 1;303 ( Pt 3):731-6.
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Isolation and characterization of a cDNA that codes for a LIM-containing protein which is developmentally regulated in heart.
Tsui SK, etal., Biochem Biophys Res Commun. 1994 Nov 30;205(1):497-505.
Crip1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 138,047,801 - 138,055,672 (+) NCBI GRCr8 mRatBN7.2 6 132,226,746 - 132,234,620 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 132,226,746 - 132,234,620 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 132,395,928 - 132,403,668 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 132,686,073 - 132,693,813 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 132,061,146 - 132,069,019 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 137,959,171 - 137,967,042 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 137,959,171 - 137,967,042 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 146,953,514 - 146,961,385 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 138,156,366 - 138,161,127 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 138,162,743 - 138,165,342 (+) NCBI Celera 6 129,765,196 - 129,773,068 (+) NCBI Celera Cytogenetic Map 6 q32 NCBI
CRIP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 105,486,886 - 105,488,947 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 105,486,317 - 105,488,947 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 105,953,223 - 105,955,284 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 105,024,594 - 105,026,171 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 105,024,593 - 105,026,167 NCBI Celera 14 86,004,651 - 86,006,568 (+) NCBI Celera Cytogenetic Map 14 q32.33 NCBI HuRef 14 86,151,418 - 86,153,286 (+) NCBI HuRef CHM1_1 14 105,890,975 - 105,892,843 (+) NCBI CHM1_1 T2T-CHM13v2.0 14 99,736,255 - 99,738,315 (+) NCBI T2T-CHM13v2.0
Crip1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 113,115,632 - 113,117,499 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 113,109,936 - 113,117,499 (+) Ensembl GRCm39 Ensembl GRCm38 12 113,152,012 - 113,153,879 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 113,146,316 - 113,153,879 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 114,390,223 - 114,392,090 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 113,599,820 - 113,601,687 (+) NCBI MGSCv36 mm8 Celera 12 114,367,853 - 114,369,721 (+) NCBI Celera Cytogenetic Map 12 F1 NCBI cM Map 12 61.59 NCBI
Crip1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955538 3,683,747 - 3,686,468 (+) NCBI ChiLan1.0 ChiLan1.0
CRIP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 106,669,273 - 106,676,689 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 105,891,619 - 105,893,192 (+) NCBI NHGRI_mPanPan1 PanPan1.1 Ensembl 14 105,914,119 - 105,915,365 (+) Ensembl panpan1.1 panPan2
CRIP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 72,784,726 - 72,786,108 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 72,784,788 - 72,786,108 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 72,294,909 - 72,296,297 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 73,072,668 - 73,074,056 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 73,072,736 - 73,074,056 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 72,753,372 - 72,754,760 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 72,801,213 - 72,802,601 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 73,192,688 - 73,194,076 (+) NCBI UU_Cfam_GSD_1.0
Crip1
LOC110258364 No map positions available.
CRIP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 83,385,005 - 83,386,596 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 83,384,529 - 83,386,903 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 70,843,615 - 70,845,255 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crip1
.
Predicted Target Of
Count of predictions: 45 Count of miRNA genes: 41 Interacting mature miRNAs: 44 Transcripts: ENSRNOT00000006835 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 2312560 Pur20 Proteinuria QTL 20 2.1 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 125628133 137801795 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
D6Wox21
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 132,232,243 - 132,232,369 (+) MAPPER mRatBN7.2 Rnor_6.0 6 137,964,666 - 137,964,791 NCBI Rnor6.0 Rnor_5.0 6 146,959,009 - 146,959,134 UniSTS Rnor5.0 RGSC_v3.4 6 138,158,583 - 138,158,708 UniSTS RGSC3.4 Celera 6 129,770,692 - 129,770,817 UniSTS Cytogenetic Map 6 q32 UniSTS
RH127355
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 16,094,614 - 16,094,816 (+) MAPPER mRatBN7.2 mRatBN7.2 6 132,225,822 - 132,226,023 (+) MAPPER mRatBN7.2 Rnor_6.0 6 137,958,248 - 137,958,448 NCBI Rnor6.0 Rnor_6.0 X 16,947,044 - 16,947,245 NCBI Rnor6.0 Rnor_5.0 6 146,952,591 - 146,952,791 UniSTS Rnor5.0 Rnor_5.0 X 17,729,253 - 17,729,454 UniSTS Rnor5.0 RGSC_v3.4 6 138,152,165 - 138,152,365 UniSTS RGSC3.4 RGSC_v3.4 X 29,089,767 - 29,089,968 UniSTS RGSC3.4 Celera X 16,165,278 - 16,165,479 UniSTS Celera 6 129,764,273 - 129,764,473 UniSTS Cytogenetic Map X q13 UniSTS Cytogenetic Map 6 q32 UniSTS
RH133355
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 6 783.4 UniSTS Cytogenetic Map 6 q32 UniSTS
Crip
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 138,055,079 - 138,055,449 (+) Marker Load Pipeline mRatBN7.2 6 132,234,027 - 132,234,397 (+) MAPPER mRatBN7.2 Rnor_6.0 6 137,966,450 - 137,966,819 NCBI Rnor6.0 Rnor_5.0 6 146,960,793 - 146,961,162 UniSTS Rnor5.0 RGSC_v3.4 6 138,160,367 - 138,160,736 UniSTS RGSC3.4 Celera 6 129,772,476 - 129,772,845 UniSTS Cytogenetic Map 6 q32 UniSTS
D10Bir4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 132,232,906 - 132,234,096 (+) MAPPER mRatBN7.2 Rnor_6.0 6 137,965,329 - 137,966,518 NCBI Rnor6.0 Rnor_5.0 6 146,959,672 - 146,960,861 UniSTS Rnor5.0 RGSC_v3.4 6 138,159,246 - 138,160,435 UniSTS RGSC3.4 Celera 6 129,771,355 - 129,772,544 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006835 ⟹ ENSRNOP00000006835
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 132,226,746 - 132,234,620 (+) Ensembl Rnor_6.0 Ensembl 6 137,959,171 - 137,967,042 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099774 ⟹ ENSRNOP00000086909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 132,230,040 - 132,234,620 (+) Ensembl
RefSeq Acc Id:
NM_001134933 ⟹ NP_001128405
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 138,047,801 - 138,055,672 (+) NCBI mRatBN7.2 6 132,226,746 - 132,234,620 (+) NCBI Rnor_6.0 6 137,959,171 - 137,967,042 (+) NCBI Rnor_5.0 6 146,953,514 - 146,961,385 (+) NCBI RGSC_v3.4 6 138,156,366 - 138,161,127 (+) ENTREZGENE Celera 6 129,765,196 - 129,773,068 (+) NCBI
Sequence:
GCCTCAGCTAGTCCTGTTCACTTCAATCCAAGTCTCAGAGCGTCTGGGGCAAGTGGCTCCCAGATCTGGTCACTGCCACGGGCTGCAGCCACTTGTGCAGGACCAGGTGCCGCCATGCCGAAGTGCCC
hide sequence
RefSeq Acc Id:
NM_001244867 ⟹ NP_001231796
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 138,053,868 - 138,055,672 (+) NCBI mRatBN7.2 6 132,232,816 - 132,234,620 (+) NCBI Rnor_6.0 6 137,965,238 - 137,967,042 (+) NCBI Rnor_5.0 6 146,953,514 - 146,961,385 (+) NCBI Celera 6 129,771,264 - 129,773,068 (+) NCBI
Sequence:
GTCCAGAGCCTACAACCTACTTCCTTCTAGCTGCAGCCACTTGTGCAGGACCAGGTGCCGCCATGCCGAAGTGCCCCAAGTGCGACAAGGAGGTGTATTTCGCTGAGCGAGTGACGTCACTAGGCAAG
hide sequence
RefSeq Acc Id:
XM_063262530 ⟹ XP_063118600
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 138,053,743 - 138,055,668 (+) NCBI
RefSeq Acc Id:
NP_001128405 ⟸ NM_001134933
- UniProtKB:
P63255 (UniProtKB/Swiss-Prot), A6KBZ1 (UniProtKB/TrEMBL)
- Sequence:
MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK
hide sequence
RefSeq Acc Id:
NP_001231796 ⟸ NM_001244867
- UniProtKB:
P63255 (UniProtKB/Swiss-Prot), A6KBZ1 (UniProtKB/TrEMBL)
- Sequence:
MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGFGRGGAESHTFK
hide sequence
Ensembl Acc Id:
ENSRNOP00000006835 ⟸ ENSRNOT00000006835
Ensembl Acc Id:
ENSRNOP00000086909 ⟸ ENSRNOT00000099774
RefSeq Acc Id:
XP_063118600 ⟸ XM_063262530
- Peptide Label:
isoform X1
- UniProtKB:
P63255 (UniProtKB/Swiss-Prot), A6KBZ1 (UniProtKB/TrEMBL)
RGD ID: 13694862 Promoter ID: EPDNEW_R5386 Type: initiation region Name: Crip1_1 Description: cysteine rich protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 137,959,189 - 137,959,249 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Crip1
cysteine rich protein 1
Crip1
cysteine-rich protein 1 (intestinal)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-09-21
Crip1
cysteine-rich protein 1 (intestinal)
Crip
cysteine-rich intestinal protein
Data merged from RGD:2404
737654 APPROVED
2008-03-06
Crip1
cysteine-rich protein 1 (intestinal)
LOC691657
similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-01-09
LOC691657
similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
LOC686293
similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
Data merged from RGD:1584271
1643240 APPROVED
2006-11-20
LOC691657
similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-19
LOC686293
similar to Cysteine-rich protein 1 (Cysteine-rich intestinal protein) (CRIP)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Crip
cysteine-rich intestinal protein
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
LIM motif-containing zinc finger protein
69817
gene_expression
expressed in intestinal cells and in cultured intestinal epithelial cells (IEC-6); expression is developmentally regulated
69817
gene_process
may be involved in cellular pathway that results in a Th2 type cytokine response
1298800
gene_regulation
expression is induced by glucocorticoid hormones and gene contains binding sites for Sp-1, AP-2, OCT and GATA-2 transcription factors as well as glucocorticoid response elements
69817
