Symbol:
Glb1
Name:
galactosidase, beta 1
RGD ID:
1597145
Description:
Enables beta-galactosidase activity and galactoside binding activity. Involved in galactose catabolic process; response to Thyroglobulin triiodothyronine; and response to cortisone. Predicted to be located in Golgi apparatus and extracellular space. Predicted to be active in lysosome. Human ortholog(s) of this gene implicated in GM1 gangliosidosis (multiple) and mucopolysaccharidosis IV (multiple). Orthologous to human GLB1 (galactosidase beta 1); PARTICIPATES IN Fabry disease pathway; galactose metabolic pathway; galactosemia pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
beta-galactosidase; galactosidase, beta 1 (mapped); Glb1_mapped
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GLB1 (galactosidase beta 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Glb1 (galactosidase, beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Glb1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GLB1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GLB1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Glb1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GLB1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GLB1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Glb1 (galactosidase beta 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Glb1 (galactosidase, beta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GLB1 (galactosidase beta 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
glb1 (galactosidase, beta 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bgal-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Ect3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Gal
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bgal-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
glb1l
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 122,963,718 - 123,036,326 (+) NCBI GRCr8 mRatBN7.2 8 114,085,508 - 114,158,127 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 114,085,508 - 114,158,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 119,702,274 - 119,775,293 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 117,901,534 - 117,974,533 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 115,744,315 - 115,817,349 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 122,439,328 - 122,511,939 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 122,439,328 - 122,511,939 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 121,752,146 - 121,824,793 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 118,791,550 - 118,864,281 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 113,332,049 - 113,404,466 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Glb1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLB1 mRNA] CTD PMID:31150632 Glb1 Rat 1,1-dichloroethene increases expression ISO Glb1 (Mus musculus) 6480464 vinylidene chloride results in increased expression of GLB1 mRNA CTD PMID:26682919 Glb1 Rat 1,2-dimethylhydrazine multiple interactions ISO Glb1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of GLB1 mRNA] CTD PMID:22206623 Glb1 Rat 1,2-dimethylhydrazine increases expression ISO Glb1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of GLB1 mRNA CTD PMID:22206623 Glb1 Rat 17alpha-ethynylestradiol affects expression ISO Glb1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of GLB1 mRNA CTD PMID:17555576 Glb1 Rat 17beta-estradiol decreases expression ISO GLB1 (Homo sapiens) 6480464 Estradiol results in decreased expression of GLB1 protein CTD PMID:17075048 Glb1 Rat 17beta-estradiol affects expression ISO Glb1 (Mus musculus) 6480464 Estradiol affects the expression of GLB1 mRNA CTD PMID:39298647 Glb1 Rat 17beta-estradiol increases expression ISO Glb1 (Mus musculus) 6480464 Estradiol results in increased expression of GLB1 mRNA CTD PMID:15289156 Glb1 Rat 17beta-estradiol multiple interactions ISO GLB1 (Homo sapiens) 6480464 Estradiol inhibits the reaction [Hydrogen Peroxide results in increased expression of GLB1 protein] and Fulvestrant inhibits the reaction [Estradiol results in decreased expression of GLB1 protein] CTD PMID:17075048 and PMID:36567042 Glb1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO GLB1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Glb1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Glb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GLB1 mRNA CTD PMID:21570461 Glb1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GLB1 mRNA CTD PMID:34747641 Glb1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Glb1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GLB1 mRNA CTD PMID:33956508 Glb1 Rat 2,4,6-tribromophenol decreases expression ISO GLB1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Glb1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GLB1 mRNA CTD PMID:21346803 Glb1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Glb1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GLB1 mRNA CTD PMID:20188158 Glb1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of GLB1 protein CTD PMID:34915118 Glb1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Glb1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of GLB1 exon CTD PMID:33297965 Glb1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Glb1 (Mus musculus) 6480464 bisphenol S affects the methylation of GLB1 gene CTD PMID:31683443 Glb1 Rat 4,4'-sulfonyldiphenol affects expression ISO GLB1 (Homo sapiens) 6480464 bisphenol S affects the expression of GLB1 protein CTD PMID:31945527 Glb1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of GLB1 mRNA CTD PMID:30047161 Glb1 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:22561310 and PMID:38483099 Glb1 Rat aldehydo-D-glucose increases activity ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased activity of GLB1 protein CTD PMID:35264022 Glb1 Rat aldehydo-D-glucose increases expression ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:17075048 more ... Glb1 Rat aldehydo-D-glucose multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytic Acid inhibits the reaction [Glucose results in increased expression of GLB1 protein]] more ... CTD PMID:23494737 more ... Glb1 Rat aldehydo-D-glucose multiple interactions EXP 6480464 NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein] more ... CTD PMID:22561310 Glb1 Rat all-trans-retinoic acid increases expression ISO GLB1 (Homo sapiens) 6480464 Tretinoin results in increased expression of GLB1 mRNA CTD PMID:23724009 Glb1 Rat alpha-D-galactose increases expression ISO Glb1 (Mus musculus) 6480464 Galactose results in increased expression of GLB1 protein CTD PMID:36792013 Glb1 Rat alpha-D-galactose multiple interactions ISO Glb1 (Mus musculus) 6480464 (1E more ... CTD PMID:36792013 Glb1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of GLB1 mRNA CTD PMID:30047161 Glb1 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO GLB1 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Arsenic Trioxide results in increased activity of GLB1 protein] more ... CTD PMID:31734849 Glb1 Rat arsane decreases expression ISO Glb1 (Mus musculus) 6480464 Arsenic results in decreased expression of GLB1 mRNA CTD PMID:36720308 Glb1 Rat arsenic acid increases activity ISO Glb1 (Mus musculus) 6480464 arsenic acid results in increased activity of GLB1 protein CTD PMID:26763397 Glb1 Rat arsenic atom decreases expression ISO Glb1 (Mus musculus) 6480464 Arsenic results in decreased expression of GLB1 mRNA CTD PMID:36720308 Glb1 Rat arsenous acid increases activity ISO Glb1 (Mus musculus) 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:36801614 Glb1 Rat arsenous acid multiple interactions ISO GLB1 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Arsenic Trioxide results in increased activity of GLB1 protein] more ... CTD PMID:31734849 Glb1 Rat arsenous acid increases activity ISO GLB1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:31734849 and PMID:36801614 Glb1 Rat arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of GLB1 protein CTD PMID:31734849 Glb1 Rat arsenous acid increases activity EXP 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:36801614 Glb1 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GLB1 mRNA CTD PMID:33854195 Glb1 Rat baicalein multiple interactions ISO GLB1 (Homo sapiens) 6480464 baicalein inhibits the reaction [Mitomycin results in increased activity of GLB1 protein] CTD PMID:34624459 Glb1 Rat benzo[a]pyrene decreases methylation ISO Glb1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of GLB1 intron CTD PMID:27901495 Glb1 Rat benzo[a]pyrene increases expression ISO GLB1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of GLB1 protein CTD PMID:35182551 Glb1 Rat beta-lapachone increases expression ISO GLB1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of GLB1 mRNA CTD PMID:38218311 Glb1 Rat betaxolol increases expression ISO GLB1 (Homo sapiens) 6480464 Betaxolol results in increased expression of GLB1 protein CTD PMID:38325520 Glb1 Rat bis(2-chloroethyl) sulfide multiple interactions ISO GLB1 (Homo sapiens) 6480464 Mustard Gas results in increased expression of and results in increased activity of GLB1 protein CTD PMID:33491125 Glb1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of GLB1 mRNA CTD PMID:26496021 Glb1 Rat bisphenol A decreases expression ISO GLB1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of GLB1 protein CTD PMID:31675489 and PMID:34186270 Glb1 Rat bisphenol A increases expression ISO GLB1 (Homo sapiens) 6480464 bisphenol A results in increased expression of GLB1 mRNA and bisphenol A results in increased expression of GLB1 protein CTD PMID:29275510 and PMID:37567409 Glb1 Rat bisphenol A increases methylation ISO Glb1 (Mus musculus) 6480464 bisphenol A results in increased methylation of GLB1 promoter CTD PMID:27312807 Glb1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GLB1 mRNA CTD PMID:25181051 Glb1 Rat bisphenol AF increases expression ISO GLB1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of GLB1 protein CTD PMID:34186270 Glb1 Rat Bisphenol B increases expression ISO GLB1 (Homo sapiens) 6480464 bisphenol B results in increased expression of GLB1 protein CTD PMID:34186270 Glb1 Rat bleomycin A2 increases activity ISO GLB1 (Homo sapiens) 6480464 Bleomycin results in increased activity of GLB1 protein CTD PMID:32554301 Glb1 Rat bortezomib multiple interactions ISO GLB1 (Homo sapiens) 6480464 TERT protein inhibits the reaction [Bortezomib results in increased expression of GLB1 protein] CTD PMID:36401358 Glb1 Rat bortezomib increases expression ISO GLB1 (Homo sapiens) 6480464 Bortezomib results in increased expression of GLB1 protein CTD PMID:36401358 Glb1 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of GLB1 protein CTD PMID:28903499 Glb1 Rat butan-1-ol multiple interactions ISO GLB1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of GLB1 mRNA CTD PMID:29432896 Glb1 Rat butanal decreases expression ISO GLB1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of GLB1 mRNA CTD PMID:26079696 Glb1 Rat cannabidiol increases activity ISO GLB1 (Homo sapiens) 6480464 Cannabidiol results in increased activity of GLB1 protein CTD PMID:36519830 Glb1 Rat carbon nanotube decreases expression ISO Glb1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Glb1 Rat carbon nanotube affects expression ISO Glb1 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of GLB1 mRNA CTD PMID:31978390 Glb1 Rat chloroquine multiple interactions ISO Glb1 (Mus musculus) 6480464 Chloroquine inhibits the reaction [(1E more ... CTD PMID:36792013 Glb1 Rat chloroquine multiple interactions ISO GLB1 (Homo sapiens) 6480464 [Chloroquine co-treated with flavokawain B] results in decreased expression of GLB1 protein CTD PMID:30025493 Glb1 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GLB1 mRNA CTD PMID:33854195 Glb1 Rat chlorpyrifos increases expression ISO Glb1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of GLB1 mRNA CTD PMID:37019170 Glb1 Rat choline multiple interactions ISO Glb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of GLB1 mRNA CTD PMID:20938992 Glb1 Rat chromium(6+) multiple interactions EXP 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased activity of GLB1 protein and S-allylcysteine inhibits the reaction [[Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased activity of GLB1 protein] CTD PMID:28988497 Glb1 Rat cis-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Isoproterenol affects the activity of GLB1 protein] CTD PMID:20391626 Glb1 Rat cisplatin increases expression ISO GLB1 (Homo sapiens) 6480464 Cisplatin results in increased expression of GLB1 protein CTD PMID:33491125 Glb1 Rat clofibrate decreases expression ISO Glb1 (Mus musculus) 6480464 Clofibrate results in decreased expression of GLB1 mRNA CTD PMID:23811191 Glb1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of GLB1 mRNA CTD PMID:22465980 Glb1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of GLB1 mRNA CTD PMID:22465980 Glb1 Rat copper(II) sulfate decreases expression ISO GLB1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of GLB1 mRNA CTD PMID:19549813 Glb1 Rat coumarin increases expression EXP 6480464 coumarin results in increased expression of GLB1 mRNA CTD PMID:18480146 Glb1 Rat cyclosporin A decreases expression ISO GLB1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GLB1 mRNA CTD PMID:25562108 Glb1 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:22561310 and PMID:38483099 Glb1 Rat D-glucose increases activity ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased activity of GLB1 protein CTD PMID:35264022 Glb1 Rat D-glucose increases expression ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:17075048 more ... Glb1 Rat D-glucose multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytic Acid inhibits the reaction [Glucose results in increased expression of GLB1 protein]] more ... CTD PMID:23494737 more ... Glb1 Rat D-glucose multiple interactions EXP 6480464 NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein] more ... CTD PMID:22561310 Glb1 Rat desferrioxamine B increases expression EXP 6480464 Deferoxamine results in increased expression of GLB1 protein CTD PMID:38483099 Glb1 Rat desferrioxamine B increases expression ISO GLB1 (Homo sapiens) 6480464 Deferoxamine results in increased expression of GLB1 protein CTD PMID:38483099 Glb1 Rat dextran sulfate multiple interactions ISO Glb1 (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in increased expression of GLB1 protein] CTD PMID:32272095 Glb1 Rat dextran sulfate increases expression ISO Glb1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of GLB1 protein CTD PMID:32272095 Glb1 Rat diarsenic trioxide increases activity ISO Glb1 (Mus musculus) 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:36801614 Glb1 Rat diarsenic trioxide multiple interactions ISO GLB1 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Arsenic Trioxide results in increased activity of GLB1 protein] more ... CTD PMID:31734849 Glb1 Rat diarsenic trioxide increases activity ISO GLB1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:31734849 and PMID:36801614 Glb1 Rat diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of GLB1 protein CTD PMID:31734849 Glb1 Rat diarsenic trioxide increases activity EXP 6480464 Arsenic Trioxide results in increased activity of GLB1 protein CTD PMID:36801614 Glb1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GLB1 mRNA CTD PMID:21266533 Glb1 Rat diethylstilbestrol increases expression ISO Glb1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of GLB1 mRNA CTD PMID:15289156 Glb1 Rat dihydroxyacetone increases activity EXP 6480464 Dihydroxyacetone results in increased activity of GLB1 protein CTD PMID:38582340 Glb1 Rat doxorubicin increases expression ISO Glb1 (Mus musculus) 6480464 Doxorubicin results in increased expression of GLB1 mRNA CTD PMID:25896364 Glb1 Rat doxorubicin decreases expression ISO GLB1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GLB1 mRNA CTD PMID:29803840 Glb1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of GLB1 mRNA CTD PMID:29391264 Glb1 Rat ferric ammonium citrate increases expression EXP 6480464 ferric ammonium citrate results in increased expression of GLB1 protein CTD PMID:38483099 Glb1 Rat ferric ammonium citrate increases expression ISO GLB1 (Homo sapiens) 6480464 ferric ammonium citrate results in increased expression of GLB1 protein CTD PMID:38483099 Glb1 Rat ferrostatin-1 multiple interactions EXP 6480464 ferrostatin-1 inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased activity of GLB1 protein] CTD PMID:33737050 Glb1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of GLB1 mRNA CTD PMID:34044035 Glb1 Rat flavokawain B multiple interactions ISO GLB1 (Homo sapiens) 6480464 [ATG5 protein affects the susceptibility to flavokawain B] which affects the expression of GLB1 protein and [Chloroquine co-treated with flavokawain B] results in decreased expression of GLB1 protein CTD PMID:30025493 Glb1 Rat flavokawain B increases expression ISO GLB1 (Homo sapiens) 6480464 flavokawain B results in increased expression of GLB1 protein CTD PMID:30025493 Glb1 Rat fluorometholone multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Fluorometholone inhibits the reaction [Glucose results in increased activity of GLB1 protein]] and Fluorometholone inhibits the reaction [Glucose results in increased activity of GLB1 protein] CTD PMID:35264022 Glb1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of GLB1 mRNA CTD PMID:24793618 Glb1 Rat folic acid multiple interactions ISO Glb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of GLB1 mRNA more ... CTD PMID:20938992 and PMID:22206623 Glb1 Rat fulvestrant multiple interactions ISO GLB1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Estradiol results in decreased expression of GLB1 protein] CTD PMID:17075048 Glb1 Rat galactose multiple interactions ISO Glb1 (Mus musculus) 6480464 (1E more ... CTD PMID:36792013 Glb1 Rat galactose increases expression ISO Glb1 (Mus musculus) 6480464 Galactose results in increased expression of GLB1 protein CTD PMID:36792013 Glb1 Rat genistein increases expression ISO Glb1 (Mus musculus) 6480464 Genistein results in increased expression of GLB1 mRNA CTD PMID:15289156 and PMID:32186404 Glb1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of GLB1 mRNA CTD PMID:24136188 Glb1 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:22561310 and PMID:38483099 Glb1 Rat glucose increases activity ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased activity of GLB1 protein CTD PMID:35264022 Glb1 Rat glucose increases expression ISO GLB1 (Homo sapiens) 6480464 Glucose results in increased expression of GLB1 protein CTD PMID:17075048 more ... Glb1 Rat glucose multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytic Acid inhibits the reaction [Glucose results in increased expression of GLB1 protein]] more ... CTD PMID:23494737 more ... Glb1 Rat glucose multiple interactions EXP 6480464 NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein] more ... CTD PMID:22561310 Glb1 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GLB1 mRNA CTD PMID:33854195 Glb1 Rat hydrogen peroxide affects expression ISO GLB1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of GLB1 mRNA CTD PMID:20044591 Glb1 Rat hydrogen peroxide multiple interactions ISO GLB1 (Homo sapiens) 6480464 er-xian decoction inhibits the reaction [Hydrogen Peroxide results in increased expression of GLB1 protein] and Estradiol inhibits the reaction [Hydrogen Peroxide results in increased expression of GLB1 protein] CTD PMID:36567042 Glb1 Rat hydrogen peroxide increases expression ISO GLB1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of GLB1 protein CTD PMID:30139380 more ... Glb1 Rat hydroquinone O-beta-D-glucopyranoside multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in increased activity of GLB1 protein] CTD PMID:32757845 Glb1 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GLB1 mRNA CTD PMID:33854195 Glb1 Rat isoprenaline multiple interactions EXP 6480464 Arbutin inhibits the reaction [Isoproterenol results in increased activity of GLB1 protein] more ... CTD PMID:20391626 more ... Glb1 Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of GLB1 protein CTD PMID:25560919 and PMID:32757845 Glb1 Rat isoprenaline affects activity EXP 6480464 Isoproterenol affects the activity of GLB1 protein CTD PMID:20391626 Glb1 Rat ivermectin decreases expression ISO GLB1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of GLB1 protein CTD PMID:32959892 Glb1 Rat L-methionine multiple interactions ISO Glb1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of GLB1 mRNA CTD PMID:20938992 Glb1 Rat lithium chloride increases activity ISO GLB1 (Homo sapiens) 6480464 Lithium Chloride results in increased activity of GLB1 protein CTD PMID:34624459 Glb1 Rat LY294002 multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Fluorometholone inhibits the reaction [Glucose results in increased activity of GLB1 protein]] CTD PMID:35264022 Glb1 Rat melatonin multiple interactions ISO GLB1 (Homo sapiens) 6480464 Melatonin inhibits the reaction [Glucose results in increased expression of GLB1 protein] CTD PMID:38000455 Glb1 Rat melphalan increases expression ISO GLB1 (Homo sapiens) 6480464 Melphalan results in increased expression of GLB1 protein CTD PMID:33491125 Glb1 Rat methamphetamine multiple interactions EXP 6480464 GATA4 protein affects the reaction [Methamphetamine results in increased expression of GLB1 protein] CTD PMID:36914120 Glb1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of GLB1 protein CTD PMID:36914120 Glb1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of GLB1 mRNA CTD PMID:30047161 Glb1 Rat methotrexate increases expression ISO GLB1 (Homo sapiens) 6480464 Methotrexate results in increased expression of GLB1 protein CTD PMID:21678067 Glb1 Rat microcystin-LR decreases activity ISO GLB1 (Homo sapiens) 6480464 cyanoginosin LR results in decreased activity of GLB1 protein CTD PMID:33474710 Glb1 Rat misonidazole increases activity EXP 6480464 Misonidazole results in increased activity of GLB1 protein CTD PMID:7459223 Glb1 Rat mitomycin C multiple interactions ISO GLB1 (Homo sapiens) 6480464 AKT1 protein affects the reaction [Mitomycin results in increased activity of GLB1 protein] more ... CTD PMID:34624459 Glb1 Rat mitomycin C increases activity ISO GLB1 (Homo sapiens) 6480464 Mitomycin results in increased activity of GLB1 protein CTD PMID:34624459 Glb1 Rat myo-inositol hexakisphosphate multiple interactions EXP 6480464 Phytic Acid inhibits the reaction [Isoproterenol results in increased activity of GLB1 protein] CTD PMID:25560919 Glb1 Rat myo-inositol hexakisphosphate multiple interactions ISO GLB1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Phytic Acid inhibits the reaction [Glucose results in increased expression of GLB1 protein]] and Phytic Acid inhibits the reaction [Glucose results in increased expression of GLB1 protein] CTD PMID:38000455 Glb1 Rat myrtenal multiple interactions EXP 6480464 myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in increased activity of GLB1 protein] CTD PMID:22436021 Glb1 Rat N(4)-hydroxycytidine decreases expression ISO Glb1 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of GLB1 mRNA CTD PMID:37748715 Glb1 Rat N-acetyl-L-cysteine multiple interactions ISO GLB1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [[Vehicle Emissions results in increased abundance of Particulate Matter] which results in increased activity of GLB1 protein] more ... CTD PMID:20884875 and PMID:31551408 Glb1 Rat N-methyl-4-phenylpyridinium affects expression ISO GLB1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the expression of GLB1 mRNA CTD PMID:12710931 Glb1 Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 ferrostatin-1 inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased activity of GLB1 protein] and pifithrin inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased activity of GLB1 protein] CTD PMID:33737050 Glb1 Rat N-methyl-4-phenylpyridinium increases activity EXP 6480464 1-Methyl-4-phenylpyridinium results in increased activity of GLB1 protein CTD PMID:33737050 Glb1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in increased activity of GLB1 protein and myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in increased activity of GLB1 protein] CTD PMID:22436021 Glb1 Rat NAD zwitterion multiple interactions EXP 6480464 NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein] and SIRT1 protein promotes the reaction [NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein]] CTD PMID:22561310 Glb1 Rat NAD(+) multiple interactions EXP 6480464 NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein] and SIRT1 protein promotes the reaction [NAD inhibits the reaction [Glucose results in increased expression of GLB1 protein]] CTD PMID:22561310 Glb1 Rat nickel atom decreases expression ISO GLB1 (Homo sapiens) 6480464 Nickel results in decreased expression of GLB1 mRNA CTD PMID:23195993 Glb1 Rat nicotinamide multiple interactions EXP 6480464 Niacinamide inhibits the reaction [Sirolimus inhibits the reaction [Glucose results in increased expression of GLB1 protein]] CTD PMID:22561310 Glb1 Rat nicotinamide increases expression EXP 6480464 Niacinamide results in increased expression of GLB1 protein CTD PMID:22561310 Glb1 Rat nitric oxide decreases activity ISO GLB1 (Homo sapiens) 6480464 Nitric Oxide results in decreased activity of GLB1 protein CTD PMID:17075048 Glb1 Rat NMN zwitterion multiple interactions ISO Glb1 (Mus musculus) 6480464 [resveratrol co-treated with Nicotinamide Mononucleotide] inhibits the reaction [RETN protein results in increased activity of GLB1 protein] CTD PMID:23827175 Glb1 Rat paraquat increases expression ISO GLB1 (Homo sapiens) 6480464 Paraquat results in increased expression of GLB1 protein CTD PMID:34064677 Glb1 Rat perfluorooctane-1-sulfonic acid affects expression ISO Glb1 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of GLB1 mRNA CTD PMID:19429403 Glb1 Rat perfluorooctanoic acid affects expression ISO Glb1 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of GLB1 mRNA CTD PMID:19429403 Glb1 Rat perifosine multiple interactions ISO GLB1 (Homo sapiens) 6480464 perifosine inhibits the reaction [Mitomycin results in increased activity of GLB1 protein] CTD PMID:34624459 Glb1 Rat phenobarbital affects expression ISO GLB1 (Homo sapiens) 6480464 Phenobarbital affects the expression of GLB1 mRNA CTD PMID:19159669 Glb1 Rat phenobarbital multiple interactions EXP 6480464 [Phenobarbital co-treated with Diethylnitrosamine] results in increased activity of GLB1 protein and myrtenal inhibits the reaction [[Phenobarbital co-treated with Diethylnitrosamine] results in increased activity of GLB1 protein] CTD PMID:22436021 Glb1 Rat picoxystrobin affects expression ISO GLB1 (Homo sapiens) 6480464 picoxystrobin affects the expression of GLB1 mRNA CTD PMID:33512557 Glb1 Rat pifithrin-alpha hydrobromide multiple interactions EXP 6480464 pifithrin inhibits the reaction [1-Methyl-4-phenylpyridinium results in increased activity of GLB1 protein] CTD PMID:33737050 Glb1 Rat pinostrobin increases phosphorylation ISO GLB1 (Homo sapiens) 6480464 pinostrobin results in increased phosphorylation of GLB1 protein CTD PMID:37164308 Glb1 Rat pirinixic acid decreases expression ISO Glb1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of GLB1 mRNA CTD PMID:20813756 and PMID:23811191 Glb1 Rat potassium dichromate multiple interactions EXP 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased activity of GLB1 protein and S-allylcysteine inhibits the reaction [[Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased activity of GLB1 protein] CTD PMID:28988497 Glb1 Rat pravastatin multiple interactions ISO GLB1 (Homo sapiens) 6480464 Pravastatin inhibits the reaction [lopinavir-ritonavir drug combination results in increased activity of GLB1 protein] and Pravastatin inhibits the reaction [Ritonavir results in increased activity of GLB1 protein] CTD PMID:20884875 Glb1 Rat pyrimidifen increases expression ISO GLB1 (Homo sapiens) 6480464 pyrimidifen results in increased expression of GLB1 mRNA CTD PMID:33512557 Glb1 Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Glucose results in increased expression of GLB1 protein] more ... CTD PMID:22561310 and PMID:23104429 Glb1 Rat resveratrol multiple interactions ISO Glb1 (Mus musculus) 6480464 [resveratrol co-treated with Nicotinamide Mononucleotide] inhibits the reaction [RETN protein results in increased activity of GLB1 protein] CTD PMID:23827175 Glb1 Rat ritonavir multiple interactions ISO GLB1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Ritonavir results in increased activity of GLB1 protein] more ... CTD PMID:20884875 Glb1 Rat ritonavir increases activity ISO GLB1 (Homo sapiens) 6480464 Ritonavir results in increased activity of GLB1 protein CTD PMID:20884875 Glb1 Rat roflumilast multiple interactions ISO GLB1 (Homo sapiens) 6480464 Roflumilast inhibits the reaction [TGFB1 protein results in increased activity of GLB1 protein] CTD PMID:39197814 Glb1 Rat rotenone affects expression ISO GLB1 (Homo sapiens) 6480464 Rotenone affects the expression of GLB1 mRNA CTD PMID:33512557 Glb1 Rat rotenone increases expression ISO GLB1 (Homo sapiens) 6480464 Rotenone results in increased expression of GLB1 protein CTD PMID:37394047 Glb1 Rat S-allylcysteine multiple interactions EXP 6480464 S-allylcysteine inhibits the reaction [[Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased activity of GLB1 protein] CTD PMID:28988497 Glb1 Rat SB 203580 multiple interactions ISO GLB1 (Homo sapiens) 6480464 pyrazolanthrone promotes the reaction [SB 203580 inhibits the reaction [Arsenic Trioxide results in increased activity of GLB1 protein]] more ... CTD PMID:31734849 Glb1 Rat silicon dioxide decreases expression ISO GLB1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of GLB1 mRNA CTD PMID:25895662 Glb1 Rat simvastatin multiple interactions ISO GLB1 (Homo sapiens) 6480464 Simvastatin inhibits the reaction [Coal Ash results in increased expression of GLB1 protein] CTD PMID:26773838 Glb1 Rat sirolimus decreases expression EXP 6480464 Sirolimus results in decreased expression of GLB1 protein CTD PMID:22561310 Glb1 Rat sirolimus multiple interactions EXP 6480464 Niacinamide inhibits the reaction [Sirolimus inhibits the reaction [Glucose results in increased expression of GLB1 protein]] more ... CTD PMID:22561310 Glb1 Rat sodium arsenate increases activity EXP 6480464 sodium arsenate results in increased activity of GLB1 protein CTD PMID:23104429 Glb1 Rat sodium arsenite increases activity EXP 6480464 sodium arsenite results in increased activity of GLB1 protein CTD PMID:23104429 Glb1 Rat sodium arsenite increases expression ISO GLB1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of GLB1 protein CTD PMID:36089002 Glb1 Rat sodium arsenite decreases expression ISO Glb1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of GLB1 mRNA CTD PMID:37682722 Glb1 Rat sodium arsenite increases expression ISO Glb1 (Mus musculus) 6480464 sodium arsenite results in increased expression of GLB1 mRNA CTD PMID:25787150 Glb1 Rat sodium arsenite multiple interactions EXP 6480464 resveratrol inhibits the reaction [sodium arsenite results in increased activity of GLB1 protein] CTD PMID:23104429 Glb1 Rat sodium fluoride increases expression ISO Glb1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of GLB1 protein CTD PMID:28918527 Glb1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of GLB1 mRNA CTD PMID:19281266 Glb1 Rat streptozocin increases expression ISO Glb1 (Mus musculus) 6480464 Streptozocin results in increased expression of GLB1 protein CTD PMID:29673160 Glb1 Rat streptozocin multiple interactions ISO Glb1 (Mus musculus) 6480464 2-amino-6-boronohexanoic acid inhibits the reaction [Streptozocin results in increased expression of GLB1 protein] more ... CTD PMID:29673160 and PMID:38483099 Glb1 Rat tamoxifen affects expression ISO Glb1 (Mus musculus) 6480464 Tamoxifen affects the expression of GLB1 mRNA CTD PMID:17555576 Glb1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of GLB1 mRNA CTD PMID:26496021 Glb1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of GLB1 mRNA CTD PMID:31150632 Glb1 Rat tetrachloromethane decreases expression ISO Glb1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GLB1 mRNA CTD PMID:31919559 Glb1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLB1 mRNA] CTD PMID:31150632 Glb1 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of GLB1 mRNA CTD PMID:33854195 Glb1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of GLB1 mRNA CTD PMID:34492290 Glb1 Rat titanium dioxide decreases methylation ISO Glb1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GLB1 gene CTD PMID:35295148 Glb1 Rat trans-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Isoproterenol affects the activity of GLB1 protein] CTD PMID:20391626 Glb1 Rat tremolite asbestos decreases expression ISO Glb1 (Mus musculus) 6480464 tremolite results in decreased expression of GLB1 mRNA CTD PMID:29279043 Glb1 Rat triphenyl phosphate affects expression ISO GLB1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of GLB1 mRNA CTD PMID:37042841 Glb1 Rat valproic acid increases expression ISO Glb1 (Mus musculus) 6480464 Valproic Acid results in increased expression of GLB1 mRNA CTD PMID:21427059 Glb1 Rat valproic acid increases expression ISO GLB1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GLB1 mRNA CTD PMID:23179753 and PMID:27188386 Glb1 Rat wogonin increases expression ISO GLB1 (Homo sapiens) 6480464 wogonin results in increased expression of GLB1 protein CTD PMID:32671444 Glb1 Rat Yessotoxin increases expression ISO GLB1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of GLB1 mRNA CTD PMID:30679557
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) alpha-D-galactose (ISO) amitrole (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) arsane (ISO) arsenic acid (ISO) arsenic atom (ISO) arsenous acid (EXP,ISO) azoxystrobin (EXP) baicalein (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) betaxolol (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bleomycin A2 (ISO) bortezomib (ISO) Brodifacoum (EXP) butan-1-ol (ISO) butanal (ISO) cannabidiol (ISO) carbon nanotube (ISO) chloroquine (ISO) chlorpyrifos (EXP,ISO) choline (ISO) chromium(6+) (EXP) cis-caffeic acid (EXP) cisplatin (ISO) clofibrate (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) coumarin (EXP) cyclosporin A (ISO) D-glucose (EXP,ISO) desferrioxamine B (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (EXP,ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) dihydroxyacetone (EXP) doxorubicin (ISO) endosulfan (EXP) ferric ammonium citrate (EXP,ISO) ferrostatin-1 (EXP) fipronil (EXP) flavokawain B (ISO) fluorometholone (ISO) flutamide (EXP) folic acid (ISO) fulvestrant (ISO) galactose (ISO) genistein (ISO) glafenine (EXP) glucose (EXP,ISO) glyphosate (EXP) hydrogen peroxide (ISO) hydroquinone O-beta-D-glucopyranoside (EXP) imidacloprid (EXP) isoprenaline (EXP) ivermectin (ISO) L-methionine (ISO) lithium chloride (ISO) LY294002 (ISO) melatonin (ISO) melphalan (ISO) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) microcystin-LR (ISO) misonidazole (EXP) mitomycin C (ISO) myo-inositol hexakisphosphate (EXP,ISO) myrtenal (EXP) N(4)-hydroxycytidine (ISO) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (EXP) NAD zwitterion (EXP) NAD(+) (EXP) nickel atom (ISO) nicotinamide (EXP) nitric oxide (ISO) NMN zwitterion (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) perifosine (ISO) phenobarbital (EXP,ISO) picoxystrobin (ISO) pifithrin-alpha hydrobromide (EXP) pinostrobin (ISO) pirinixic acid (ISO) potassium dichromate (EXP) pravastatin (ISO) pyrimidifen (ISO) resveratrol (EXP,ISO) ritonavir (ISO) roflumilast (ISO) rotenone (ISO) S-allylcysteine (EXP) SB 203580 (ISO) silicon dioxide (ISO) simvastatin (ISO) sirolimus (EXP) sodium arsenate (EXP) sodium arsenite (EXP,ISO) sodium fluoride (ISO) Soman (EXP) streptozocin (ISO) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (ISO) trans-caffeic acid (EXP) tremolite asbestos (ISO) triphenyl phosphate (ISO) valproic acid (ISO) wogonin (ISO) Yessotoxin (ISO)
1.
Genetically controlled variation of "acid" beta-galactosidase detected in Rattus norvegicus by isoelectric focusing.
Douglas TC, etal., Genetics. 1982 Mar;100(3):455-73.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Effect of cortisone or L-triiodothyronine administration to pregnant rats on the activity of fetal intestinal disaccharidases and lysosomal acid beta-galactosidase.
Jumawan J, etal., Biol Neonate. 1977;32(3-4):211-7.
4.
Hormonal control of postnatal development of ileal neuraminidase and acid beta-galactosidase.
Leeper LL and Henning SJ, Biol Neonate. 1983;44(1):28-35.
5.
Acrosomal and lysosomal isoenzymes of beta-galactosidase and N-acetyl-beta-glucosaminidase in rat testis.
Majumder GC and Turkington RW, Biochemistry. 1974 Jul 2;13(14):2857-64.
6.
New GLB1 mutation in siblings with Morquio type B disease presenting with mental regression.
Mayer FQ, etal., Mol Genet Metab. 2009 Mar;96(3):148. doi: 10.1016/j.ymgme.2008.11.159. Epub 2008 Dec 16.
7.
beta-galactosidase gene mutations affecting the lysosomal enzyme and the elastin-binding protein in GM1-gangliosidosis patients with cardiac involvement.
Morrone A, etal., Hum Mutat. 2000;15(4):354-66.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Mutation analyses in 17 patients with deficiency in acid beta-galactosidase: three novel point mutations and high correlation of mutation W273L with Morquio disease type B.
Paschke E, etal., Hum Genet. 2001 Aug;109(2):159-66.
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
Alterations in certain lysosomal glycohydrolases and cathepsins in rats on dexamethasone administration.
Rajashree S and Puvanakrishnan R, Mol Cell Biochem. 1996 Jan 26;154(2):165-70.
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Identification of 14 novel GLB1 mutations, including five deletions, in 19 patients with GM1 gangliosidosis from South America.
Santamaria R, etal., Clin Genet. 2007 Mar;71(3):273-9.
16.
Rat brain contains high levels of mannose-6-phosphorylated glycoproteins including lysosomal enzymes and palmitoyl-protein thioesterase, an enzyme implicated in infantile neuronal lipofuscinosis.
Sleat DE, etal., J Biol Chem. 1996 Aug 9;271(32):19191-8.
17.
Systemic AAV9 gene transfer in adult GM1 gangliosidosis mice reduces lysosomal storage in CNS and extends lifespan.
Weismann CM, etal., Hum Mol Genet. 2015 Aug 1;24(15):4353-64. doi: 10.1093/hmg/ddv168. Epub 2015 May 10.
Glb1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 122,963,718 - 123,036,326 (+) NCBI GRCr8 mRatBN7.2 8 114,085,508 - 114,158,127 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 114,085,508 - 114,158,127 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 119,702,274 - 119,775,293 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 117,901,534 - 117,974,533 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 115,744,315 - 115,817,349 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 122,439,328 - 122,511,939 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 122,439,328 - 122,511,939 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 121,752,146 - 121,824,793 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 118,791,550 - 118,864,281 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 113,332,049 - 113,404,466 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
GLB1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 32,961,108 - 33,097,146 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 32,996,609 - 33,097,202 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 33,002,600 - 33,138,638 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 33,013,104 - 33,113,698 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 33,013,234 - 33,113,632 NCBI Celera 3 32,980,743 - 33,081,754 (-) NCBI Celera Cytogenetic Map 3 p22.3 NCBI HuRef 3 32,977,821 - 33,078,667 (-) NCBI HuRef CHM1_1 3 32,988,097 - 33,088,744 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 32,962,888 - 33,098,917 (-) NCBI T2T-CHM13v2.0
Glb1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 114,230,146 - 114,303,447 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 114,230,144 - 114,303,966 (+) Ensembl GRCm39 Ensembl GRCm38 9 114,401,078 - 114,474,379 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 114,401,076 - 114,474,898 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 114,310,237 - 114,383,495 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 114,249,817 - 114,323,075 (+) NCBI MGSCv36 mm8 Celera 9 114,872,858 - 114,948,660 (+) NCBI Celera Cytogenetic Map 9 F3 NCBI cM Map 9 64.4 NCBI
Glb1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955421 231,076 - 312,500 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955421 230,957 - 311,504 (-) NCBI ChiLan1.0 ChiLan1.0
GLB1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 32,943,061 - 33,083,071 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 32,947,825 - 33,088,024 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 32,892,039 - 33,031,959 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 33,231,208 - 33,336,804 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 33,231,209 - 33,336,804 (-) Ensembl panpan1.1 panPan2
GLB1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 3,721,768 - 3,814,209 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 3,732,040 - 3,814,191 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 3,776,393 - 3,858,177 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 3,992,209 - 4,074,051 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 3,992,152 - 4,074,337 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 3,826,915 - 3,908,721 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 3,954,230 - 4,036,008 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 3,927,851 - 4,009,519 (+) NCBI UU_Cfam_GSD_1.0
Glb1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 190,209,844 - 190,301,836 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 23,348,416 - 23,440,196 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 23,348,431 - 23,440,271 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GLB1
GLB1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 77,480,895 - 77,592,130 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 77,480,598 - 77,592,120 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 50,859,532 - 50,971,400 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Glb1
.
Predicted Target Of
Count of predictions: 105 Count of miRNA genes: 81 Interacting mature miRNAs: 94 Transcripts: ENSRNOT00000013632 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 1599689 Iddm24 Insulin dependent diabetes mellitus QTL 24 4.72 0.001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 8 112834440 118649220 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH130801
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 114,157,310 - 114,157,530 (+) MAPPER mRatBN7.2 Rnor_6.0 8 122,511,123 - 122,511,342 NCBI Rnor6.0 Rnor_5.0 8 121,823,977 - 121,824,196 UniSTS Rnor5.0 RGSC_v3.4 8 118,863,465 - 118,863,684 UniSTS RGSC3.4 Celera 8 113,403,642 - 113,403,861 UniSTS RH 3.4 Map 8 1203.8 UniSTS Cytogenetic Map 8 q32 UniSTS
RH134983
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 114,095,665 - 114,095,863 (+) MAPPER mRatBN7.2 Rnor_6.0 8 122,449,487 - 122,449,684 NCBI Rnor6.0 Rnor_5.0 8 121,762,341 - 121,762,538 UniSTS Rnor5.0 RGSC_v3.4 8 118,801,709 - 118,801,906 UniSTS RGSC3.4 Celera 8 113,342,195 - 113,342,392 UniSTS RH 3.4 Map 8 1202.0 UniSTS Cytogenetic Map 8 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013632 ⟹ ENSRNOP00000013632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 114,085,508 - 114,158,127 (+) Ensembl Rnor_6.0 Ensembl 8 122,439,328 - 122,511,939 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095071 ⟹ ENSRNOP00000080740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 114,100,165 - 114,158,127 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112983 ⟹ ENSRNOP00000080639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 114,085,508 - 114,158,127 (+) Ensembl
RefSeq Acc Id:
NM_001108192 ⟹ NP_001101662
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 122,963,718 - 123,036,326 (+) NCBI mRatBN7.2 8 114,085,508 - 114,158,127 (+) NCBI Rnor_6.0 8 122,439,328 - 122,511,939 (+) NCBI Rnor_5.0 8 121,752,146 - 121,824,793 (+) NCBI RGSC_v3.4 8 118,791,550 - 118,864,281 (+) RGD Celera 8 113,332,049 - 113,404,466 (+) RGD
Sequence:
CTCAGTAACCCCCGGAGGTGGAGCGGCTGGCCAGAGCGCCCACTGCAGAGTGGAGCGGTCCCATCGCGGCGCCGTCATGTTCCGGGTCCCCCTGTGTATGCTGCTCCCGCTCCTGGCGCTCCTGCAGT
hide sequence
RefSeq Acc Id:
NP_001101662 ⟸ NM_001108192
- Peptide Label:
precursor
- UniProtKB:
D3ZUM4 (UniProtKB/TrEMBL), A6I3N5 (UniProtKB/TrEMBL), A0A8I6G4Z3 (UniProtKB/TrEMBL)
- Sequence:
MFRVPLCMLLPLLALLQLLGAAHSFYNVSQRTFELDYKRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRLLKMKMAGLDAIQTYVPWNFHEPQPGQYDFSGDRDVEHFIQLAHQLGLLVILRPGPYIC
hide sequence
Ensembl Acc Id:
ENSRNOP00000013632 ⟸ ENSRNOT00000013632
Ensembl Acc Id:
ENSRNOP00000080740 ⟸ ENSRNOT00000095071
Ensembl Acc Id:
ENSRNOP00000080639 ⟸ ENSRNOT00000112983
RGD ID: 13696354 Promoter ID: EPDNEW_R6879 Type: initiation region Name: Glb1_1 Description: galactosidase, beta 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 122,439,360 - 122,439,420 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Glb1
galactosidase, beta 1
Glb1_predicted
galactosidase, beta 1 (predicted)
'predicted' is removed
2292626 APPROVED
2007-04-11
Glb1_predicted
galactosidase, beta 1 (predicted)
Glb1_mapped
galactosidase, beta 1 (mapped)
Data merged from RGD:2699
737654 APPROVED
2007-01-09
Glb1_predicted
galactosidase, beta 1 (predicted)
Glb1
galactosidase, beta 1
Gene type set to predicted; nomenclature changed appropriately
1299863 APPROVED
2007-01-09
galactosidase, beta 1
Glb1
galactosidase, beta 1 (mapped)
Name updated
1299863 APPROVED
2006-11-20
Glb1
galactosidase, beta 1 (mapped)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-11-17
Glb1_mapped
galactosidase, beta 1 (mapped)
Symbol and Name updated
1556543 APPROVED
2002-06-10
Glb1
Galactosidase, beta 1
Symbol and Name status set to approved
70586 APPROVED
