Advanced Search (OLGA)

Gene: Cops9 (COP9 signalosome subunit 9) Rattus norvegicus

Analyze

Symbol:

Cops9

Name:

COP9 signalosome subunit 9

RGD ID:

1596701

Description:

Predicted to be involved in several processes, including cellular response to UV; negative regulation of protein localization to nucleolus; and negative regulation of protein neddylation. Predicted to be located in chromatin; cytoplasm; and nucleoplasm. Predicted to be part of COP9 signalosome. Orthologous to human COPS9 (COP9 signalosome subunit 9); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

COP9 signalosome complex subunit 9; hypothetical protein LOC681389; LOC681389; myeloma overexpressed 2; Myeov2; similar to CG17059-PA; uncharacterized protein LOC681389

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COPS9 (COP9 signalosome subunit 9)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cops9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cops9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COPS9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COPS9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cops9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COPS9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COPS9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cops9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cops9 (COP9 signalosome subunit 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	COPS9 (COP9 signalosome subunit 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	COPS9 (COP9 signalosome subunit 9)	Alliance	DIOPT (HGNC\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cops9 (COP9 signalosome subunit 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cops9 (COP9 signalosome subunit 9)	Alliance	DIOPT (OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cops9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cops9	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17059	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG17059	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cops9	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cops9	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	100,657,276 - 100,662,206 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	100,657,276 - 100,662,206 (-)	Ensembl				GRCr8
mRatBN7.2	9	93,209,843 - 93,214,774 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	93,209,843 - 93,213,317 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	101,645,777 - 101,650,703 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	106,781,547 - 106,786,473 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	105,137,697 - 105,142,623 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	99,813,332 - 99,818,262 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	99,813,332 - 99,818,262 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	99,478,497 - 99,483,427 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	91,858,160 - 91,863,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	90,746,832 - 90,751,762 (-)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fenthion (ISO)

indometacin (ISO)

methimazole (EXP)

ozone (ISO)

PCB138 (ISO)

propiconazole (EXP)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to UV (ISO)

negative regulation of protein localization to nucleolus (ISO)

negative regulation of protein neddylation (ISO)

positive regulation of cell population proliferation (ISO)

Cellular Component

chromatin (ISO)

COP9 signalosome (IEA,ISO)

cytoplasm (ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:23776465	PMID:26456823

Genomics

Comparative Map Data

Cops9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	100,657,276 - 100,662,206 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	9	100,657,276 - 100,662,206 (-)	Ensembl				GRCr8
mRatBN7.2	9	93,209,843 - 93,214,774 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	93,209,843 - 93,213,317 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	9	101,645,777 - 101,650,703 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	106,781,547 - 106,786,473 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	105,137,697 - 105,142,623 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	99,813,332 - 99,818,262 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	99,813,332 - 99,818,262 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	9	99,478,497 - 99,483,427 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	9	91,858,160 - 91,863,090 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	9	90,746,832 - 90,751,762 (-)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

COPS9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	240,126,548 - 240,136,347 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	240,126,563 - 240,136,807 (-)	Ensembl			hg38	GRCh38
GRCh37	2	241,065,980 - 241,075,764 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	240,714,653 - 240,724,437 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	2	234,739,018 - 234,748,802 (-)	NCBI		Celera
Cytogenetic Map	2	q37.3	NCBI
HuRef	2	232,823,878 - 232,833,679 (-)	NCBI		HuRef
CHM1_1	2	241,071,605 - 241,081,395 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	240,619,322 - 240,629,121 (-)	NCBI		T2T-CHM13v2.0

Cops9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	92,564,867 - 92,569,707 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	92,564,867 - 92,569,707 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	92,637,145 - 92,641,985 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	92,637,145 - 92,641,985 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	94,533,722 - 94,538,562 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	94,467,551 - 94,472,391 (-)	NCBI		MGSCv36	mm8
Celera	1	95,581,052 - 95,585,891 (-)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	46.55	NCBI

Cops9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955542	1,131,110 - 1,135,871 (+)	Ensembl
ChiLan1.0	NW_004955542	1,131,110 - 1,135,871 (+)	NCBI	ChiLan1.0	ChiLan1.0

COPS9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	142,780,324 - 142,787,110 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	142,795,290 - 142,802,076 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	127,373,916 - 127,379,543 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	246,186,565 - 246,196,506 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	246,186,565 - 246,196,471 (-)	Ensembl			panPan2	panpan1.1

COPS9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ROS_Cfam_1.0	25	50,750,815 - 50,754,214 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	25	50,592,674 - 50,596,080 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	50,338,835 - 50,342,222 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	50,616,326 - 50,619,735 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cops9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	191,923,586 - 191,927,491 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936745	1,291,702 - 1,295,834 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COPS9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	139,260,478 - 139,264,211 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	139,260,471 - 139,264,252 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	153,946,107 - 153,950,286 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COPS9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	126,163,883 - 126,169,915 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	73,237,545 - 73,243,101 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cops9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624847	4,679,059 - 4,683,969 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624847	4,679,059 - 4,684,041 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cops9
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	164,604,658 - 164,609,494 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cops9
20 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	37
Count of miRNA genes:	31
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000056600
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56047863	101047863	Rat
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	63376862	108376862	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	65657365	108376720	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	86720043	110356905	Rat
2303178	Bp334	Blood pressure QTL 334	3.7	0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	86720043	121768150	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	64220169	109220169	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	64220169	109220169	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	44458256	121768150	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	64220169	109220169	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	68875497	121768150	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	83161999	118999486	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	85262459	109044727	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	85262459	118999486	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	48718864	108376862	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	64220169	109220169	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC169124	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR465509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DV717666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000056600 ⟹ ENSRNOP00000053439

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	100,657,276 - 100,660,647 (-)	Ensembl
mRatBN7.2 Ensembl	9	93,209,843 - 93,213,317 (-)	Ensembl
Rnor_6.0 Ensembl	9	99,813,332 - 99,818,262 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135389 ⟹ ENSRNOP00000104739

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	9	100,657,276 - 100,662,206 (-)	Ensembl

RefSeq Acc Id:

NM_001109044 ⟹ NP_001102514

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	100,657,276 - 100,662,206 (-)	NCBI
mRatBN7.2	9	93,209,843 - 93,214,774 (-)	NCBI
Rnor_6.0	9	99,813,332 - 99,818,262 (-)	NCBI
Rnor_5.0	9	99,478,497 - 99,483,427 (-)	NCBI
RGSC_v3.4	9	91,858,160 - 91,863,090 (-)	RGD
Celera	9	90,746,832 - 90,751,762 (-)	RGD

Sequence:

show sequence

GCCGCCAGTCTCGAGATGAAACCAGCTGTGGATGAGATGTTTCCCGAGGGCGCGGGGCCCTATG
TAGACTTGGATGAGGCTGGAGGTAGCACCGGGCTCCTGATGGACTTGGCAGCCAATGAAAAGGC
AGTTCATGCGGACTTTTTTAACGATTTTGAAGATCTCTTTGATGATGATGATGTCCAGTGAGGC
CGTCGGGTCATATATGCTCCATGTCTGTGATGTGTCTGGAGTCTCCGGGGACAGGATCACCTGA
TGGTAGACACGTGTGACTATCACTAGGTATCAAGACCTAGTCAGCCAATAGGGGAACTGCCTGA
ACCAACTGGGTACTGATGCCTCTGGGAACGCCAGCCCCATGTCCTTGTTTAAATTAATAAAGAG
CACTAGAACCACAGGGTGGTTTTAATTCCTGTGCTTTTAGATGCAGATGGACTCCCCCCCCCCC
CCCATGTGTGAACACAGAATAAAGCATGGCACCGCAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102514	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI69124	(Get FASTA)	NCBI Sequence Viewer
	EDL91982	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053439.3
	ENSRNOP00000104739
	ENSRNOP00000104739.1

RefSeq Acc Id:	NP_001102514 ⟸ NM_001109044
- UniProtKB:	B5DFN0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDVQ hide sequence

Ensembl Acc Id:

ENSRNOP00000053439 ⟸ ENSRNOT00000056600

Ensembl Acc Id:

ENSRNOP00000104739 ⟸ ENSRNOT00000135389

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DFN0-F1-model_v2	AlphaFold	B5DFN0	1-57	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696867

Promoter ID:

EPDNEW_R7391

Type:

multiple initiation site

Name:

Cops9_1

Description:

COP9 signalosome subunit 9

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	9	99,818,256 - 99,818,316	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1596701	AgrOrtholog
BioCyc Gene	G2FUF-26678	BioCyc
Ensembl Genes	ENSRNOG00000037402	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000056600.4	UniProtKB/TrEMBL
	ENSRNOT00000135389	ENTREZGENE
	ENSRNOT00000135389.1	UniProtKB/TrEMBL
InterPro	MYEOV2	UniProtKB/TrEMBL
KEGG Report	rno:681389	UniProtKB/TrEMBL
NCBI Gene	681389	ENTREZGENE
PANTHER	PTHR28562	UniProtKB/TrEMBL
Pfam	MYEOV2	UniProtKB/TrEMBL
PhenoGen	Cops9	PhenoGen
RatGTEx	ENSRNOG00000037402	RatGTEx
UniProt	A0ABK0L4V7_RAT	UniProtKB/TrEMBL
	B5DFN0	ENTREZGENE, UniProtKB/TrEMBL
	F7F834_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-27	Cops9	COP9 signalosome subunit 9	Myeov2	myeloma overexpressed 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Myeov2	myeloma overexpressed 2	LOC681389	similar to CG17059-PA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC681389	similar to CG17059-PA	LOC684000	similar to CG17059-PA	Data merged from RGD:1595244	1643240	APPROVED
2006-11-20	LOC681389	similar to CG17059-PA			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC684000	similar to CG17059-PA			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message