Advanced Search (OLGA)

Gene: Hacd1 (3-hydroxyacyl-CoA dehydratase 1) Rattus norvegicus

Analyze

Symbol:

Hacd1

Name:

3-hydroxyacyl-CoA dehydratase 1

RGD ID:

1595507

Description:

Predicted to enable enzyme binding activity; hydroxyapatite binding activity; and very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity. Predicted to be involved in several processes, including cementum mineralization; lipid biosynthetic process; and positive regulation of cell-substrate adhesion. Predicted to act upstream of or within myotube differentiation; regulation of G1/S transition of mitotic cell cycle; and regulation of G2/M transition of mitotic cell cycle. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in congenital myopathy. Orthologous to human HACD1 (3-hydroxyacyl-CoA dehydratase 1); PARTICIPATES IN unsaturated fatty acid biosynthetic pathway; INTERACTS WITH aconitine; alpha-Zearalanol; amphetamine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC680115; protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a; protein tyrosine phosphatase-like protein A; protein-tyrosine phosphatase-like member A; Ptpla; similar to protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a isoform 1; very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ATG14 (autophagy related 14)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HACD1 (3-hydroxyacyl-CoA dehydratase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hacd1 (3-hydroxyacyl-CoA dehydratase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PHS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PHS1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hacd1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hacd1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hpo-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hpo-8	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hacd1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	81,992,284 - 82,014,676 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	81,992,292 - 82,014,592 (-)	Ensembl				GRCr8
mRatBN7.2	17	77,081,508 - 77,106,114 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	77,083,740 - 77,106,073 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	80,533,754 - 80,556,385 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	84,369,169 - 84,391,796 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	78,417,074 - 78,439,703 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	81,173,238 - 81,196,012 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	81,173,713 - 81,187,739 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	82,917,839 - 82,940,613 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	88,239,568 - 88,253,571 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	76,417,114 - 76,430,942 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Myopathy 11 (ISO)

congenital structural myopathy (ISO)

genetic disease (ISO)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-methylcholine (ISO)

5-fluorouracil (ISO)

aconitine (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

caffeine (EXP)

cantharidin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (EXP)

clofibrate (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

dexamethasone (ISO)

diazinon (ISO)

dichloroacetic acid (ISO)

dioxygen (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

gentamycin (EXP)

indole-3-methanol (EXP)

inulin (ISO)

mercury dibromide (ISO)

methoxyacetic acid (EXP)

methylmercury chloride (EXP,ISO)

Monobutylphthalate (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

propiconazole (ISO)

SB 431542 (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cementum mineralization (ISO)

fatty acid biosynthetic process (IEA)

fatty acid elongation (ISO)

fatty acid metabolic process (IEA)

lipid metabolic process (IEA)

myotube differentiation (ISO)

positive regulation of cell-substrate adhesion (ISO)

protein-containing complex assembly (ISO)

regulation of G1/S transition of mitotic cell cycle (ISO)

regulation of G2/M transition of mitotic cell cycle (ISO)

sphingolipid biosynthetic process (ISO)

very long-chain fatty acid biosynthetic process (ISO)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IEA)

membrane (IEA)

Molecular Function

3-hydroxyacyl-CoA dehydratase activity (ISO)

enzyme binding (ISO)

hydroxyapatite binding (ISO)

lyase activity (IEA)

protein binding (ISO)

very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

unsaturated fatty acid biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18554506	PMID:22067203	PMID:22106411	PMID:25263524

Genomics

Comparative Map Data

Hacd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	81,992,284 - 82,014,676 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	81,992,292 - 82,014,592 (-)	Ensembl				GRCr8
mRatBN7.2	17	77,081,508 - 77,106,114 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	77,083,740 - 77,106,073 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	80,533,754 - 80,556,385 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	84,369,169 - 84,391,796 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	78,417,074 - 78,439,703 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	81,173,238 - 81,196,012 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	81,173,713 - 81,187,739 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	82,917,839 - 82,940,613 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	88,239,568 - 88,253,571 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	76,417,114 - 76,430,942 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

HACD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	17,589,032 - 17,617,374 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	17,588,316 - 17,617,430 (-)	Ensembl			hg38	GRCh38
GRCh37	10	17,631,031 - 17,659,373 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	17,671,964 - 17,699,379 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	17,672,275 - 17,699,379	NCBI
Celera	10	17,565,146 - 17,593,075 (-)	NCBI		Celera
Cytogenetic Map	10	p12.33	NCBI
HuRef	10	17,544,972 - 17,572,460 (-)	NCBI		HuRef
CHM1_1	10	17,632,313 - 17,659,761 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	17,607,536 - 17,635,876 (-)	NCBI		T2T-CHM13v2.0

Hacd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	14,031,642 - 14,060,846 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	13,855,093 - 14,060,847 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	14,026,831 - 14,056,035 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	13,850,282 - 14,056,135 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	13,948,458 - 13,977,662 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	13,944,585 - 13,973,789 (-)	NCBI		MGSCv36	mm8
Celera	2	13,931,573 - 13,960,708 (-)	NCBI		Celera
Cytogenetic Map	2	A1- A2	NCBI
cM Map	2	10.3	NCBI

Hacd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955429	10,384,708 - 10,406,945 (+)	Ensembl
ChiLan1.0	NW_004955429	10,394,046 - 10,406,945 (+)	NCBI	ChiLan1.0	ChiLan1.0

HACD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	30,437,852 - 30,465,114 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	30,443,173 - 30,472,403 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	17,911,158 - 17,940,075 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	18,182,727 - 18,196,854 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	18,183,125 - 18,209,361 (-)	Ensembl			panPan2	panpan1.1

HACD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	19,362,488 - 19,383,090 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	19,362,403 - 19,383,090 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	16,464,086 - 16,484,685 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	19,652,419 - 19,672,996 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	19,652,098 - 19,674,773 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	16,855,006 - 16,875,380 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	17,690,591 - 17,711,318 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	18,310,361 - 18,330,963 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hacd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	18,233,190 - 18,244,697 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936520	9,716,224 - 9,727,841 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936520	9,716,178 - 9,725,949 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HACD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	43,897,162 - 43,929,409 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	43,901,590 - 43,929,441 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	48,592,803 - 48,619,692 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HACD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	17,537,945 - 17,565,831 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	17,536,611 - 17,565,383 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	23,182,977 - 23,210,775 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hacd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624796	10,295,993 - 10,313,108 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624796	10,295,957 - 10,315,222 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hacd1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	9,538,005 - 9,562,017 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hacd1
89 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	88
Count of miRNA genes:	83
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000063911
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	70613502	86062352	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	65154872	93515804	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	68550040	93515804	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63697147	82818564	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	64569820	86954580	Rat

Markers in Region

RH141259

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	77,095,553 - 77,095,750 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	81,185,520 - 81,185,716	NCBI	Rnor6.0
Rnor_5.0	17	82,930,121 - 82,930,317	UniSTS	Rnor5.0
RGSC_v3.4	17	88,251,380 - 88,251,576	UniSTS	RGSC3.4
Celera	17	76,428,751 - 76,428,947	UniSTS
RH 3.4 Map	17	786.9	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

BE099735

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	17	786.9	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

AA893268

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	77,091,163 - 77,091,413 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	81,181,130 - 81,181,379	NCBI	Rnor6.0
Rnor_5.0	17	82,925,731 - 82,925,980	UniSTS	Rnor5.0
RGSC_v3.4	17	88,246,990 - 88,247,239	UniSTS	RGSC3.4
Celera	17	76,424,381 - 76,424,630	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	91	59	6	355	191	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001101001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006254293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005495327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005495329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005495330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AM260199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000063911 ⟹ ENSRNOP00000059743

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	77,083,742 - 77,105,970 (-)	Ensembl
Rnor_6.0 Ensembl	17	81,173,713 - 81,187,739 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099131 ⟹ ENSRNOP00000080696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	81,992,292 - 82,014,592 (-)	Ensembl
mRatBN7.2 Ensembl	17	77,083,740 - 77,106,073 (-)	Ensembl

RefSeq Acc Id:

NM_001101001 ⟹ NP_001094471

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,992,287 - 82,014,592 (-)	NCBI
mRatBN7.2	17	77,083,742 - 77,106,048 (-)	NCBI
Rnor_6.0	17	81,173,708 - 81,196,012 (-)	NCBI
Rnor_5.0	17	82,917,839 - 82,940,613 (-)	NCBI
RGSC_v3.4	17	88,239,568 - 88,253,571 (-)	RGD
Celera	17	76,417,114 - 76,430,942 (-)	RGD

Sequence:

show sequence

GCGGCCGCGGGCAGCGGCGCTTCAGTGGCGCGCTCAGCCGGCCCCTCCCGCTCCTGTGCGCTGC
TCCTCCGGCTCCGCGTGCGCGGTCACCATGGCGTCCAGTGAGGAGGACGGCACCAACGGCGCCT
CCGAGGCCAGCGACGAGAAGGAAGCCACCGGCAAGCGGAGACGCCTAGGCTTCCTGGCCACCGC
CTGGCTCACCTTCTACAATATCGCCATGACCGCCGGGTGGTTGGTTCTAGCTATTGCAATGGTA
CGCTTTTATATGGAAAAAGGAACACACAGAGGTTTATATAAAAGCATTCAGAAGACACTTAAAT
TTTTCCAAACATTTGCTTTGCTTGAGGTAGTCCACTGTCTGATTGGAATCGTACCCACTTCTGT
GCTTGTGACTGGGGTCCAAGTGAGTTCACGAATCTTCATGGTATGGCTCATTACTCACAGTATA
AAACCCATCCAGAACGAAGAGAGCGTGGTGCTTTTTCTGGTCTCCTGGACTGTGACCGAGATCA
CTCGCTATTCCTTCTACACATTCAGTCTCCTCGACCACTTGCCGCACTTCATTAAATGGGCCAG
ATACAATTTTTTTATCATCTTATATCCCGTTGGAGTTGCTGGAGAGCTTCTCACGATATACGCT
GCCTTGCCTTACGTAAAGAAATCAGGGATGTTTTCAGTAAGGCTTCCTAACAAGTACAACGTCT
CTTTCGACTACTACTATTTTCTTCTCATAACCATGGCCTCGTATATACCGCTGTTTCCTCAGCT
CTATTTTCATATGTTACGTCAAAGAAGAAAGGTGCTTCATGGCGAGGTGATCGTAGAGAAGGAC
GATTAAATGGTCCCTACAAACAAGGTGCTTTTTTCAGAAAAACCGGATTACTTGAGTCCAAGTT
TTAATAATAAGAATAAACAACTTCATGAAATAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039096059 ⟹ XP_038951987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,992,284 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,081,510 - 77,106,113 (-)	NCBI

RefSeq Acc Id:

XM_039096060 ⟹ XP_038951988

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,994,061 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,085,516 - 77,106,114 (-)	NCBI

RefSeq Acc Id:

XM_039096061 ⟹ XP_038951989

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	82,004,111 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,094,080 - 77,106,114 (-)	NCBI

RefSeq Acc Id:

XM_063276730 ⟹ XP_063132800

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,992,284 - 82,014,676 (-)	NCBI

RefSeq Acc Id:

XR_005495327

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,992,284 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,081,508 - 77,106,114 (-)	NCBI

RefSeq Acc Id:

XR_005495329

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,994,173 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,085,516 - 77,106,114 (-)	NCBI

RefSeq Acc Id:

XR_005495330

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	81,994,076 - 82,014,676 (-)	NCBI
mRatBN7.2	17	77,085,534 - 77,106,114 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001094471	(Get FASTA)	NCBI Sequence Viewer
	XP_038951987	(Get FASTA)	NCBI Sequence Viewer
	XP_038951988	(Get FASTA)	NCBI Sequence Viewer
	XP_038951989	(Get FASTA)	NCBI Sequence Viewer
	XP_063132800	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAJ91092	(Get FASTA)	NCBI Sequence Viewer
	EDL78726	(Get FASTA)	NCBI Sequence Viewer
	EDL78727	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080696
	ENSRNOP00000080696.2

RefSeq Acc Id:

NP_001094471 ⟸ NM_001101001

- UniProtKB:

A1IVX5 (UniProtKB/TrEMBL), A0A8I5ZQB2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASSEEDGTNGASEASDEKEATGKRRRLGFLATAWLTFYNIAMTAGWLVLAIAMVRFYMEKGTH
RGLYKSIQKTLKFFQTFALLEVVHCLIGIVPTSVLVTGVQVSSRIFMVWLITHSIKPIQNEESV
VLFLVSWTVTEITRYSFYTFSLLDHLPHFIKWARYNFFIILYPVGVAGELLTIYAALPYVKKSG
MFSVRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD

hide sequence

Ensembl Acc Id:

ENSRNOP00000059743 ⟸ ENSRNOT00000063911

RefSeq Acc Id:	XP_038951987 ⟸ XM_039096059
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZQB2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038951988 ⟸ XM_039096060
- Peptide Label:	isoform X2
- UniProtKB:	F1LSK3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038951989 ⟸ XM_039096061
- Peptide Label:	isoform X4

Ensembl Acc Id:

ENSRNOP00000080696 ⟸ ENSRNOT00000099131

RefSeq Acc Id:	XP_063132800 ⟸ XM_063276730
- Peptide Label:	isoform X3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LSK3-F1-model_v2	AlphaFold	F1LSK3	1-211	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1595507	AgrOrtholog
BioCyc Gene	G2FUF-8605	BioCyc
BioCyc Pathway	PWY-5080 [very long chain fatty acid biosynthesis I]	BioCyc
	PWY-6598 [sciadonate biosynthesis]	BioCyc
	PWY-7036 [very long chain fatty acid biosynthesis II]	BioCyc
	PWY-7049 [icosapentaenoate biosynthesis II (6-desaturase, mammals)]	BioCyc
	PWY-7592 [arachidonate biosynthesis III (6-desaturase, mammals)]	BioCyc
	PWY-7606 [docosahexaenoate biosynthesis III (6-desaturase, mammals)]	BioCyc
	PWY-7619 [juniperonate biosynthesis]	BioCyc
	PWY-7726 [(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase)]	BioCyc
	PWY-8041 [ultra-long-chain fatty acid biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-5080	BioCyc
	PWY-6598	BioCyc
	PWY-7036	BioCyc
	PWY-7049	BioCyc
	PWY-7592	BioCyc
	PWY-7606	BioCyc
	PWY-7619	BioCyc
	PWY-7726	BioCyc
	PWY-8041	BioCyc
Ensembl Genes	ENSRNOG00000043192	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000099131	ENTREZGENE
	ENSRNOT00000099131.2	UniProtKB/TrEMBL
InterPro	Tyr_Pase-like_PTPLA	UniProtKB/TrEMBL
KEGG Report	rno:680115	UniProtKB/TrEMBL
NCBI Gene	680115	ENTREZGENE
PANTHER	PTPLA	UniProtKB/TrEMBL
	VERY-LONG-CHAIN (3R)-3-HYDROXYACYL-COA DEHYDRATASE 1	UniProtKB/TrEMBL
Pfam	PTPLA	UniProtKB/TrEMBL
PhenoGen	Hacd1	PhenoGen
RatGTEx	ENSRNOG00000043192	RatGTEx
UniProt	A0A8I5ZQB2	ENTREZGENE
	A1IVX5	ENTREZGENE, UniProtKB/TrEMBL
	F1LSK3	ENTREZGENE
UniProt Secondary	A0A8I5ZQB2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-02-04	Hacd1	3-hydroxyacyl-CoA dehydratase 1	Ptpla	protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Ptpla	protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a	LOC683916	similar to protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a isoform 1	Data merged from RGD:1596577	1643240	APPROVED
2008-03-05	Ptpla	protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a	LOC680115	similar to protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a isoform 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC680115	similar to protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a isoform 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC683916	similar to protein tyrosine phosphatase-like (proline instead of catalytic arginine), member a isoform 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIA

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

BioCyc Pathways