Symbol:
Mbd2
Name:
methyl-CpG binding domain protein 2
RGD ID:
1595452
Description:
Predicted to enable several functions, including C2H2 zinc finger domain binding activity; RNA binding activity; and methyl-CpG binding activity. Involved in several processes, including cellular response to serotonin; maternal behavior; and regulation of gene expression. Located in chromatin. Used to study choline deficiency disease. Biomarker of choline deficiency disease and transient cerebral ischemia. Human ortholog(s) of this gene implicated in schizophrenia. Orthologous to human MBD2 (methyl-CpG binding domain protein 2); PARTICIPATES IN CHD family mediated chromatin remodeling pathway; DNA modification pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC291525; LOC680172; LOC684150; methyl-CpG-binding domain protein 2; MGC188552; similar to Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding protein MBD2)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 66,449,196 - 66,516,112 (+) NCBI GRCr8 mRatBN7.2 18 64,174,002 - 64,240,795 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 64,174,002 - 64,240,794 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 66,250,441 - 66,317,290 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 66,943,914 - 67,010,763 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 64,791,202 - 64,858,194 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 65,814,026 - 65,885,115 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 65,814,026 - 65,885,114 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 64,990,480 - 65,060,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 67,281,440 - 67,348,558 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 67,378,120 - 67,421,847 (+) NCBI Celera 18 62,237,373 - 62,304,615 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
(+)-catechin (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (EXP,ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bicalutamide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) cadmium dichloride (EXP) caffeine (ISO) carbon nanotube (ISO) choline (ISO) coumarin (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) fumonisin B1 (ISO) genistein (ISO) hydroquinone (ISO) indometacin (ISO) L-methionine (ISO) menadione (ISO) mercury dibromide (ISO) methidathion (ISO) methyl methanesulfonate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) permethrin (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) resveratrol (ISO) S-adenosyl-L-methioninate (ISO) S-adenosyl-L-methionine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (ISO) sulindac (EXP) testosterone (EXP) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zebularine (ISO)
Biological Process
cellular response to serotonin (IEP) chromatin remodeling (IEA,ISO) DNA methylation-dependent constitutive heterochromatin formation (IBA,IEA,ISO) embryonic organ development (IEP) epigenetic regulation of gene expression (IEP) maternal behavior (IEA,IEP,ISO) negative regulation of transcription by RNA polymerase II (IBA,IEA,ISO) positive regulation of Wnt signaling pathway (IEA,ISO) protein-containing complex assembly (IEA,ISO) regulation of cell population proliferation (IEA,ISO) regulation of transcription by RNA polymerase II (IMP) response to bisphenol A (IEP) response to estradiol (IEP) response to mechanical stimulus (IEP) response to nutrient levels (IEP) ventricular cardiac muscle tissue development (IEP) Wnt signaling pathway (IEA,ISO)
Cellular Component
chromatin (IDA,IEA,ISO) cytoplasm (IEA,ISO) cytosol (IEA,ISO) heterochromatin (IEA,ISO) histone deacetylase complex (IEA,ISO) nucleolus (ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) NuRD complex (IEA,ISO)
1.
The nucleosome remodeling and deacetylase complex in development and disease.
Basta J and Rauchman M, Transl Res. 2014 May 10. pii: S1931-5244(14)00166-2. doi: 10.1016/j.trsl.2014.05.003.
2.
On how mammalian transcription factors recognize methylated DNA.
Buck-Koehntop BA and Defossez PA, Epigenetics. 2013 Feb;8(2):131-7. doi: 10.4161/epi.23632. Epub 2013 Jan 16.
3.
Kindling induces the mRNA expression of methyl DNA-binding factors in the adult rat hippocampus.
Francis J, etal., Neuroscience. 2002;113(1):79-87.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
A folate- and methyl-deficient diet alters the expression of DNA methyltransferases and methyl CpG binding proteins involved in epigenetic gene silencing in livers of F344 rats.
Ghoshal K, etal., J Nutr. 2006 Jun;136(6):1522-7.
6.
Differential expression of methyl CpG-binding domain containing factor MBD3 in the developing and adult rat brain.
Jung BP, etal., J Neurobiol. 2003 May;55(2):220-32.
7.
Transient forebrain ischemia alters the mRNA expression of methyl DNA-binding factors in the adult rat hippocampus.
Jung BP, etal., Neuroscience. 2002;115(2):515-24.
8.
Epigenetic regulation of neonatal cardiomyocytes differentiation.
Kou CY, etal., Biochem Biophys Res Commun. 2010 Sep 17;400(2):278-83. doi: 10.1016/j.bbrc.2010.08.064. Epub 2010 Aug 22.
9.
Gestational choline deficiency causes global and Igf2 gene DNA hypermethylation by up-regulation of Dnmt1 expression.
Kovacheva VP, etal., J Biol Chem. 2007 Oct 26;282(43):31777-88. Epub 2007 Aug 27.
10.
Global DNA methylation, DNMT1, and MBD2 in patients with rheumatoid arthritis.
Liu CC, etal., Immunol Lett. 2011 Mar 30;135(1-2):96-9. doi: 10.1016/j.imlet.2010.10.003. Epub 2010 Oct 16.
11.
Effect of Methyl-CpG binding domain protein 2 (MBD2) on AMD-like lesions in ApoE-deficient mice.
Pan JR, etal., J Huazhong Univ Sci Technolog Med Sci. 2014 Jun;34(3):408-14. doi: 10.1007/s11596-014-1292-2. Epub 2014 Jun 18.
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Neonatal exposure to estradiol/bisphenol A alters promoter methylation and expression of Nsbp1 and Hpcal1 genes and transcriptional programs of Dnmt3a/b and Mbd2/4 in the rat prostate gland throughout life.
Tang WY, etal., Endocrinology. 2012 Jan;153(1):42-55. doi: 10.1210/en.2011-1308. Epub 2011 Nov 22.
14.
The methylated-DNA binding protein MBD2 enhances NGFI-A (egr-1)-mediated transcriptional activation of the glucocorticoid receptor.
Weaver IC, etal., Philos Trans R Soc Lond B Biol Sci. 2014 Sep 26;369(1652). pii: 20130513. doi: 10.1098/rstb.2013.0513.
15.
Chronic cerebrovascular hypoperfusion affects global DNA methylation and histone acetylation in rat brain.
Wu X, etal., Neurosci Bull. 2013 Dec;29(6):685-92. doi: 10.1007/s12264-013-1345-8. Epub 2013 May 28.
16.
Genetic association study between methyl-CpG-binding domain genes and schizophrenia among Chinese family trios.
Xie B, etal., Psychiatr Genet. 2014 Oct;24(5):221-4. doi: 10.1097/YPG.0000000000000042.
Mbd2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 66,449,196 - 66,516,112 (+) NCBI GRCr8 mRatBN7.2 18 64,174,002 - 64,240,795 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 64,174,002 - 64,240,794 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 66,250,441 - 66,317,290 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 66,943,914 - 67,010,763 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 64,791,202 - 64,858,194 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 65,814,026 - 65,885,115 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 65,814,026 - 65,885,114 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 64,990,480 - 65,060,941 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 67,281,440 - 67,348,558 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 67,378,120 - 67,421,847 (+) NCBI Celera 18 62,237,373 - 62,304,615 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
MBD2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 54,151,606 - 54,224,669 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 54,151,606 - 54,224,669 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 51,677,976 - 51,751,039 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 49,934,573 - 50,005,156 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 49,983,044 - 50,005,156 NCBI Celera 18 48,536,865 - 48,607,453 (-) NCBI Celera Cytogenetic Map 18 q21.2 NCBI HuRef 18 48,533,225 - 48,606,305 (-) NCBI HuRef CHM1_1 18 51,672,993 - 51,746,130 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 54,354,681 - 54,427,744 (-) NCBI T2T-CHM13v2.0
Mbd2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 70,701,298 - 70,761,769 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 70,701,260 - 70,759,202 (+) Ensembl GRCm39 Ensembl GRCm38 18 70,568,225 - 70,629,134 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 70,568,189 - 70,626,131 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 70,727,946 - 70,785,785 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 70,693,557 - 70,751,499 (+) NCBI MGSCv36 mm8 Celera 18 71,855,127 - 71,913,052 (+) NCBI Celera Cytogenetic Map 18 E2 NCBI cM Map 18 44.54 NCBI
Mbd2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 38,767,419 - 38,830,204 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 38,761,668 - 38,829,830 (-) NCBI ChiLan1.0 ChiLan1.0
MBD2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 71,682,971 - 71,755,813 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 57,372,347 - 57,448,428 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 47,534,356 - 47,609,481 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 50,876,490 - 50,946,077 (-) NCBI panpan1.1 PanPan1.1 panPan2
MBD2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 21,232,260 - 21,283,687 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 21,235,967 - 21,283,346 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 22,214,129 - 22,277,156 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 21,116,138 - 21,179,161 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 21,116,177 - 21,179,029 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 21,172,397 - 21,235,448 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 21,064,613 - 21,127,587 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 21,336,222 - 21,399,248 (+) NCBI UU_Cfam_GSD_1.0
Mbd2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 34,305,611 - 34,380,215 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 9,545,907 - 9,619,267 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 9,512,350 - 9,619,250 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MBD2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 103,735,192 - 103,752,402 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 103,683,077 - 103,768,372 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 113,947,945 - 113,959,372 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MBD2
Mbd2
.
Predicted Target Of
Count of predictions: 32 Count of miRNA genes: 30 Interacting mature miRNAs: 31 Transcripts: ENSRNOT00000016112 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331770 Bp234 Blood pressure QTL 234 3.807 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 71893566 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
RH129492
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 64,240,637 - 64,240,852 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,884,958 - 65,885,172 NCBI Rnor6.0 Rnor_5.0 18 65,060,784 - 65,060,998 UniSTS Rnor5.0 RGSC_v3.4 18 67,348,401 - 67,348,615 UniSTS RGSC3.4 Celera 18 62,304,458 - 62,304,672 UniSTS RH 3.4 Map 18 663.5 UniSTS Cytogenetic Map 18 q12.1 UniSTS
BE107285
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 66,463,162 - 66,463,316 (+) Marker Load Pipeline mRatBN7.2 18 64,187,808 - 64,187,962 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,827,833 - 65,827,986 NCBI Rnor6.0 Rnor_5.0 18 65,004,287 - 65,004,440 UniSTS Rnor5.0 RGSC_v3.4 18 67,295,202 - 67,295,355 UniSTS RGSC3.4 Celera 18 62,251,267 - 62,251,420 UniSTS RH 3.4 Map 18 662.8 UniSTS Cytogenetic Map 18 q12.1 UniSTS
AU049630
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 64,192,935 - 64,193,083 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,832,960 - 65,833,107 NCBI Rnor6.0 Rnor_5.0 18 65,009,414 - 65,009,561 UniSTS Rnor5.0 RGSC_v3.4 18 67,300,329 - 67,300,476 UniSTS RGSC3.4 Celera 18 62,256,394 - 62,256,541 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016112 ⟹ ENSRNOP00000016112
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 64,174,002 - 64,240,794 (+) Ensembl Rnor_6.0 Ensembl 18 65,814,026 - 65,885,114 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113824 ⟹ ENSRNOP00000086975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 64,174,002 - 64,187,615 (+) Ensembl
RefSeq Acc Id:
NM_001115025 ⟹ NP_001108497
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 66,449,358 - 66,516,112 (+) NCBI mRatBN7.2 18 64,174,002 - 64,240,795 (+) NCBI Rnor_6.0 18 65,814,026 - 65,885,115 (+) NCBI Rnor_5.0 18 64,990,480 - 65,060,941 (+) NCBI RGSC_v3.4 18 67,281,440 - 67,348,558 (+) RGD Celera 18 62,237,373 - 62,304,615 (+) RGD
Sequence:
GGCTGGATGCGCGCGCACCCGGGGGGAGGCCGCTGCTGCCCGGAGCAGGAGGAGGGGGAGAGCGCGGCGGGCGGCAGCGGCGCTGGCGGCGACTCCGCCATAGAGCAGGGGGGCCAGGGCAGCGCGCT
hide sequence
RefSeq Acc Id:
XM_063277586 ⟹ XP_063133656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 66,449,202 - 66,507,200 (+) NCBI
RefSeq Acc Id:
XM_063277587 ⟹ XP_063133657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 66,449,196 - 66,463,352 (+) NCBI
RefSeq Acc Id:
NP_001108497 ⟸ NM_001115025
- UniProtKB:
B0BNM2 (UniProtKB/TrEMBL), D4A986 (UniProtKB/TrEMBL)
- Sequence:
MRAHPGGGRCCPEQEEGESAAGGSGAGGDSAIEQGGQGSALAPSPVSGVRREGARGGGRGRGRWKQAARGGGVCGRGRGRGRGRGRGRGRGRGRGRPQSGVSGLGGDGGAGGCGVGSSGGVAPRRDPV
hide sequence
Ensembl Acc Id:
ENSRNOP00000016112 ⟸ ENSRNOT00000016112
Ensembl Acc Id:
ENSRNOP00000086975 ⟸ ENSRNOT00000113824
RefSeq Acc Id:
XP_063133657 ⟸ XM_063277587
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AFM4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133656 ⟸ XM_063277586
- Peptide Label:
isoform X1
RGD ID: 13700855 Promoter ID: EPDNEW_R11378 Type: initiation region Name: Mbd2_1 Description: methyl-CpG binding domain protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 65,814,057 - 65,814,117 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-01
Mbd2
methyl-CpG binding domain protein 2
LOC684150
similar to Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding protein MBD2)
Data merged from RGD:1593905
737654 APPROVED
2008-03-05
Mbd2
methyl-CpG binding domain protein 2
LOC680172
similar to Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding protein MBD2)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC680172
similar to Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding protein MBD2)
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-20
LOC684150
similar to Methyl-CpG-binding domain protein 2 (Methyl-CpG-binding protein MBD2)
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-01-12
Mbd2_predicted
methyl-CpG binding domain protein 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
