Advanced Search (OLGA)

Gene: Rad21 (RAD21 cohesin complex component) Rattus norvegicus

Analyze

Symbol:

Rad21

Name:

RAD21 cohesin complex component

RGD ID:

1594529

Description:

Enables DNA-binding transcription factor binding activity and lncRNA binding activity. Involved in negative regulation of apoptotic process; regulation of cytokine production; and response to hypoxia. Located in nucleus. Human ortholog(s) of this gene implicated in Cornelia de Lange syndrome 4; endometrial cancer; hepatocellular carcinoma; and lung non-small cell carcinoma. Orthologous to human RAD21 (RAD21 cohesin complex component); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

double-strand-break repair protein rad21 homolog; MGC116373; RAD21 homolog; RAD21 homolog (S. pombe); similar to HR21spA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAD21 (RAD21 cohesin complex component)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAD21 (RAD21 cohesin complex component)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rad21 (RAD21 cohesin complex component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rad21a (RAD21 cohesin complex component a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rad21b (RAD21 cohesin complex component b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MCD1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	MCD1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	coh-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	coh-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	scc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	scc-1	Alliance	DIOPT (OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vtd	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rad21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	85,177,716 - 85,204,657 (-)	Ensembl				GRCr8
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	85,183,451 - 85,210,398 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,384,656 - 87,411,603 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,211,563 - 87,238,505 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	80,164,565 - 80,191,459 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cerebral Hemorrhage (IMP)

colorectal carcinoma (ISO)

Cornelia de Lange syndrome (ISO)

Cornelia de Lange syndrome 1 (ISO)

Cornelia de Lange syndrome 4 (ISO)

Desbuquois dysplasia (ISO)

endometrial cancer (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

lung non-small cell carcinoma (ISO)

malignant pleural mesothelioma (ISO)

Mungan Syndrome (ISO)

myeloid leukemia (ISO)

myeloid leukemia associated with Down Syndrome (ISO)

oral squamous cell carcinoma (ISO)

Spinal Cord Injuries (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-butoxyethanol (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroperoxycyclophosphamide (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Brevetoxin B (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (ISO)

coumestrol (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

Echimidine (ISO)

Enterolactone (ISO)

finasteride (EXP)

genistein (ISO)

glafenine (EXP)

glycyrrhizinic acid (ISO)

GSK-J4 (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

Lasiocarpine (ISO)

methapyrilene (EXP)

methimazole (EXP)

Mezerein (ISO)

microcystin-LR (ISO)

monocrotaline (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphoramide mustard (EXP)

pirinixic acid (ISO)

quercetin (ISO)

riddelliine (ISO)

rotenone (ISO)

saccharin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

torcetrapib (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin looping (ISO)

chromosome segregation (IEA)

negative regulation of G2/M transition of mitotic cell cycle (IEA,ISO)

negative regulation of gene expression (IMP)

negative regulation of glial cell apoptotic process (IMP)

negative regulation of interleukin-1 beta production (IMP)

negative regulation of mitotic metaphase/anaphase transition (IEA,ISO)

negative regulation of neuron apoptotic process (IMP)

negative regulation of tumor necrosis factor production (IMP)

positive regulation of gene expression (IMP)

positive regulation of interleukin-10 production (IMP)

positive regulation of sister chromatid cohesion (IEA,ISO)

protein localization to chromatin (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA,ISO)

response to hypoxia (IEP)

sister chromatid cohesion (IEA)

Cellular Component

chromatin (IEA,ISO)

chromosome (IEA)

chromosome, centromeric region (IEA,ISO)

cohesin complex (IEA,ISO)

condensed nuclear chromosome (IEA,ISO)

mitotic cohesin complex (IEA,ISO)

nuclear matrix (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IDA,IEA,ISO)

Molecular Function

cis-regulatory region sequence-specific DNA binding (IEA,ISO)

DNA-binding transcription factor binding (IPI)

lncRNA binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	PPARγ/RAD21 alleviates peripheral secondary brain injury in rat cerebral hemorrhage model through promoting M2 polarization of microglial cells.	Jiao Y, etal., Int Immunopharmacol. 2023 Jan;114:109572. doi: 10.1016/j.intimp.2022.109572. Epub 2022 Dec 18.
3.	Mechanism of glycyrrhizic acid inhibition of Kaposi's sarcoma-associated herpesvirus: disruption of CTCF-cohesin-mediated RNA polymerase II pausing and sister chromatid cohesion.	Kang H and Lieberman PM, J Virol. 2011 Nov;85(21):11159-69. doi: 10.1128/JVI.00720-11. Epub 2011 Aug 31.
4.	Polymorphisms in mitotic checkpoint-related genes can influence survival outcomes of early-stage non-small cell lung cancer.	Kang HG, etal., Oncotarget. 2017 Jun 27;8(37):61777-61785. doi: 10.18632/oncotarget.18693. eCollection 2017 Sep 22.
5.	[Endometrial cancer in young women--clinical and molecular aspects].	Lapińska-Szumczyk S, etal., Ginekol Pol. 2014 Oct;85(10):754-9.
6.	LncRNA MIAT activates vascular endothelial growth factor A through RAD21 to promote nerve injury repair in acute spinal cord injury.	Li D, etal., Mol Cell Endocrinol. 2021 May 15;528:111244. doi: 10.1016/j.mce.2021.111244. Epub 2021 Mar 17.
7.	Cell Cycle Genes Are Potential Diagnostic and Prognostic Biomarkers in Hepatocellular Carcinoma.	Liping X, etal., Biomed Res Int. 2020 Jun 7;2020:6206157. doi: 10.1155/2020/6206157. eCollection 2020.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	MiR-320b/RAD21 axis affects hepatocellular carcinoma radiosensitivity to ionizing radiation treatment through DNA damage repair signaling.	Wang J, etal., Cancer Sci. 2021 Feb;112(2):575-588. doi: 10.1111/cas.14751. Epub 2020 Dec 31.
14.	Correlation of invasion and metastasis of cancer cells, and expression of the RAD21 gene in oral squamous cell carcinoma.	Yamamoto G, etal., Virchows Arch. 2006 Apr;448(4):435-41. doi: 10.1007/s00428-005-0132-y. Epub 2006 Jan 14.
15.	Genomic and regulatory characteristics of significant transcription factors in colorectal cancer metastasis.	Zhou B and Guo R, Sci Rep. 2018 Dec 13;8(1):17836. doi: 10.1038/s41598-018-36168-8.

Additional References at PubMed

PMID:10375619	PMID:11590136	PMID:12477932	PMID:18499658	PMID:19468298	PMID:19946888	PMID:21111234	PMID:22419665	PMID:22628566	PMID:22780989	PMID:23242214	PMID:23920377
PMID:24797475	PMID:31505169

Genomics

Comparative Map Data

Rad21
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	85,177,716 - 85,204,657 (-)	Ensembl				GRCr8
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	85,183,451 - 85,210,398 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,384,656 - 87,411,603 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,211,563 - 87,238,505 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	80,164,565 - 80,191,459 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

RAD21
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	116,845,934 - 116,874,776 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	116,845,934 - 116,874,849 (-)	Ensembl			hg38	GRCh38
GRCh37	8	117,858,173 - 117,887,015 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	117,927,355 - 117,956,182 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	117,927,354 - 117,956,182	NCBI
Celera	8	114,046,862 - 114,075,794 (-)	NCBI		Celera
Cytogenetic Map	8	q24.11	NCBI
HuRef	8	113,184,591 - 113,213,523 (-)	NCBI		HuRef
CHM1_1	8	117,898,409 - 117,927,335 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	117,974,085 - 118,002,938 (-)	NCBI		T2T-CHM13v2.0

Rad21
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	51,826,000 - 51,856,934 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	51,825,636 - 51,855,143 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	51,962,604 - 51,993,538 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	51,962,240 - 51,991,747 (-)	Ensembl			mm10	GRCm38
MGSCv37	15	51,794,150 - 51,823,306 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	51,792,680 - 51,821,636 (-)	NCBI		MGSCv36	mm8
Celera	15	53,535,633 - 53,555,853 (-)	NCBI		Celera
Cytogenetic Map	15	C	NCBI
cM Map	15	19.54	NCBI

Rad21
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	22,941,479 - 22,966,837 (-)	Ensembl
ChiLan1.0	NW_004955417	22,941,549 - 22,966,395 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAD21
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	134,252,362 - 134,281,273 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	109,767,758 - 109,796,718 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	113,520,456 - 113,549,339 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	116,063,503 - 116,092,421 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	116,063,503 - 116,092,421 (-)	Ensembl			panPan2	panpan1.1

RAD21
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	16,337,563 - 16,368,041 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	16,338,972 - 16,368,035 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	16,338,678 - 16,369,154 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	16,626,236 - 16,656,848 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	16,626,236 - 16,656,850 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	16,369,666 - 16,400,273 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	16,469,992 - 16,500,602 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	16,711,252 - 16,741,853 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rad21
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	21,951,734 - 21,978,780 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	29,377,734 - 29,407,312 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	29,377,793 - 29,403,422 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAD21
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	21,772,855 - 21,802,715 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	21,772,821 - 21,802,453 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	23,059,570 - 23,262,558 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAD21
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	111,486,356 - 111,515,641 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	111,486,048 - 111,507,729 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	28,811,005 - 28,840,566 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rad21
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	15,131,005 - 15,158,155 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624763	15,131,106 - 15,157,512 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rad21
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	226,305,500 - 226,332,431 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rad21
233 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	190
Count of miRNA genes:	149
Interacting mature miRNAs:	172
Transcripts:	ENSRNOT00000006209
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	45113903	90113903	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	71103011	106126789	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	24179478	86817926	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	51700643	96700643	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
1298525	Cm1	Cardiac mass QTL 1	2.7		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	7	56625161	101625161	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	55498584	105834451	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	10112916	99900612	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	48475049	93475049	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	1	104117804	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	82111245	96700643	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	82111245	95485241	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	62963207	107963207	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	21541977	86817926	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
2303582	Gluco53	Glucose level QTL 53	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	7	48603087	93603087	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Markers in Region

RH131367

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,293,712 - 83,293,892 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,517,601 - 91,517,780	NCBI	Rnor6.0
Rnor_5.0	7	92,161,392 - 92,161,571	UniSTS	Rnor5.0
RGSC_v3.4	7	88,273,494 - 88,273,673	UniSTS	RGSC3.4
Celera	7	80,170,411 - 80,170,590	UniSTS
RH 3.4 Map	7	550.3	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH137734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,288,539 - 83,288,693 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,512,428 - 91,512,581	NCBI	Rnor6.0
Rnor_5.0	7	92,156,219 - 92,156,372	UniSTS	Rnor5.0
RGSC_v3.4	7	88,268,321 - 88,268,474	UniSTS	RGSC3.4
Celera	7	80,165,238 - 80,165,391	UniSTS
RH 3.4 Map	7	550.4	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH134178

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,287,932 - 83,288,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,511,821 - 91,512,001	NCBI	Rnor6.0
Rnor_5.0	7	92,155,612 - 92,155,792	UniSTS	Rnor5.0
RGSC_v3.4	7	88,267,714 - 88,267,894	UniSTS	RGSC3.4
Celera	7	80,164,631 - 80,164,811	UniSTS
RH 3.4 Map	7	549.1	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH139481

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,288,539 - 83,288,756 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,512,428 - 91,512,644	NCBI	Rnor6.0
Rnor_5.0	7	92,156,219 - 92,156,435	UniSTS	Rnor5.0
RGSC_v3.4	7	88,268,321 - 88,268,537	UniSTS	RGSC3.4
Celera	7	80,165,238 - 80,165,454	UniSTS
RH 3.4 Map	7	551.8	UniSTS
Cytogenetic Map	7	q31	UniSTS

AW530029

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,316,640 - 83,316,791 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,540,504 - 91,540,654	NCBI	Rnor6.0
Rnor_5.0	7	92,184,580 - 92,184,730	UniSTS	Rnor5.0
RGSC_v3.4	7	88,296,534 - 88,296,684	UniSTS	RGSC3.4
Celera	7	80,193,290 - 80,193,440	UniSTS
RH 3.4 Map	7	541.8	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006209 ⟹ ENSRNOP00000006209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	85,177,716 - 85,204,657 (-)	Ensembl
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116638 ⟹ ENSRNOP00000095133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	83,288,697 - 83,314,805 (-)	Ensembl

RefSeq Acc Id:

NM_001025701 ⟹ NP_001020872

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	RGD
Celera	7	80,164,565 - 80,191,459 (-)	RGD

Sequence:

show sequence

CGGCAGCCATCTTGTTTGTTTGAGTGAATCGGAAAGGAGGCGGCGGCCGTGGCGGTGGCGGGAG
CAACTCCGAGGCTACACCGCACAAGGGCTCCCCCTTTCCCCGCCCCCTCCCCCGACCCTTTCCC
CCCTCCCCGGGCCACCCACCCCTCCCAGCTCCCCGCAGAGATACAGGTTTCTTTTTATTTCATA
GCAAATAAGAAAAATGTTCTACGCACATTTTGTCCTCAGCAAACGAGGGCCTCTGGCCAAAATT
TGGCTGGCGGCCCATTGGGACAAGAAGCTAACCAAAGCCCATGTGTTTGAGTGTAACTTAGAAA
GCAGTGTGGAAAGTATCATCTCACCTAAGGTGAAGATGGCGCTGCGGACGTCAGGACACCTCCT
CCTGGGCGTAGTCCGCATCTATCACAGGAAAGCCAAATACCTCCTCGCGGACTGTAATGAAGCA
TTTATTAAAATAAAGATGGCTTTTCGGCCAGGTGTTGTCGATCTACCTGAGGAAAATCGGGAAG
CGGCTTATAATGCCATTACTTTACCTGAGGAATTTCACGATTTTGACCAGCCACTGCCAGACTT
AGATGACATTGACGTCGCCCAGCAGTTCAGCTTGAACCAGAGCAGAGTAGAAGAGATAACCATG
AGAGAAGAAGTTGGGAACATCAGTATCCTACAGGAAAATGACTTCGGTGACTTTGGAATGGATG
ACCGTGAAATCATGAGAGAAGGCAGTGCTTTCGAGGATGACGACATGTTAGTGAGCACCAGTGC
TTCCAACCTCCTCCTAGAGCCTGAGCAGAGCACCAGCAACCTGAATGAAAAGATTAACCATTTA
GAGTATGAGGACCAGTACAAAGATGATAACTTTGGAGAAGGCAATGATGGTGGTATATTGGACG
ACAAACTTATAAGTAATAATGACGGTGGCATCTTTGACGACCCCCCTGCCTTGTCTGAGACGGG
GGTCATGTTGCCAGAGCAGCCTGCACACGATGATATGGATGAGGATGACAATGGCTCGTTGGGT
GGGCCTGATAGTCCTGACTCTGTGGATCCTGTTGAACCAATGCCAACCATGACTGATCAGACAA
CACTCGTCCCAAATGAGGAAGAAGCTTTTGCATTGGAGCCCATTGATATAACTGTCAAAGAAAC
AAAAGCCAAGAGGAAGAGGAAGCTGATTGTTGACAGTGTCAAGGAATTGGATAGTAAGACAATT
AGAGCCCAACTCAGTGATTACTCTGATATTGTTACAACTCTGGACCTGGCCCCGCCCACCAAGA
AGCTGATGATGTGGAAAGAGACGGGAGGGGTGGAGAAGCTCTTCTCCTTACCAGCGCAGCCATT
GTGGAATAACCGACTACTGAAGCTCTTTACACGCTGCCTTACTCCACTTGTACCAGAAGACCTT
AGGAAAAGAAGGAAAGGGGGAGAGGCAGATAATCTGGATGAGTTCCTCAAAGAGTTCGAGAACC
CAGAGGTCCCCCGAGAGGAGCAGCAGCCGCAGCCACAGCAGCAGCAGGCGCAGCGTGACGTCAT
TGATGAGCCCATTATAGAAGAGCCAAGCCGCCTTCAGGACTCAGTGATGGAGGCCAGCAGAACA
AACATAGAAGAGTCGGCCATGCCTCCACCACCCCCTCAGGGAGTTAAGCGAAAAGCCGGGCAAG
TAGACCCGGAGCCTGCGATTCCTCCTCAGCAGGTAGAGCAAATGGAAATACCACCAGTAGAACT
TCCCCCAGAAGAACCTCCCAATATCTGTCAGCTGATACCGGAGTTAGAGCTTCTACCAGAAAAG
GAGAAGGAGAAAGAGAAGGAGAAGGAGGAGGAAGAAGAGGAGGAGGATGAAGATGCTTCAGGGG
GTGATCAGGATCAAGAGGAAAGGAGATGGAACAAAAGGACTCAGCAGATGCTTCATGGTCTTCA
GCGAGCTCTTGCTAAAACTGGAGCAGAGTCGATCAGTTTGCTTGAGCTATGTCGAAACACAAAC
CGAAAGCAGGCAGCAGCAAAGTTCTACAGCTTTTTGGTTCTTAAAAAGCAGCAAGCCATCGAGC
TCACACAGGAAGAGCCGTACAGTGACATCATTGCAACACCTGGACCAAGGTTCCACATCATCTG
AGGAGCTAGACGCTTTAGAGCTAGTGTTAACTCACTAGGACGTACAAATTGCCCCATGTGTAGG
GCACCAGAACCCTTTAAGGAAGTTTTTAGATTTTTGTTTGTACAAAATCTTTGCCTTTTCTTTC
TTCATTTTTTTCCCCCAGTGTTTCTAATTTTGTCGACCATCTTTTAAGGGAAACTGCTTATTTG
GGTTGGGTTTGTATTCCTGGAGAAGACAGTACCCCCAAGAACCCAGAAGACTTTTAACAGTTCA
GAGCAGATGTGTGCAATATTGGTGCATGTAAGAATATGGAGTAACAGTCAAAAGTCCCCATTTT
TATGTTAGTTTTCCATTACTTTGTTTAAAAGAAAAACCTGCCTAGGAAAATGCCTGACACTTTA
AGAACTGTGGTTTGAGTCCCTTGACAGGAAGAGAAAAATGTCTTCCCATCAGTGAAACCAACAG
TCTGGTTAACCACTGTACCTGGGGATAGTATGTGAGGCATCGTGCTTGTCTTCTTGATCATGTT
TTAAAGTAAGTCAGTTCATAATGAGCAAGAACTTGTGAGTTTGTGCTGACTGATCCTCTTCGAC
TATTATGTTCTGAAATCATTCCGTGACTCTTAGGAACTCTGACGCTAGTGCAGCTCAGAATGAC
AGACTTCTGCAGTGGCGGGACTCCTCAAGGGCTGCAGATCGCTTTCTCAAAGGTGTCTGGATGT
TTGCTTGAGTAATGAGATCATGAAAATAGAAATTCCCCTGCCTGCTGAAGGGCAAACCAATGAG
AAACTACCCCAGATTGACTTCCTTTAAGCAAACAGTGCTGTAAAAACTAATGGCTTCTCTGATA
TTTATTATAAATGTTAGTACTGAGCTTCCAATGCTGCACACTCCTGTGTTTGAAACTATTTTAA
TAACTTTGCAACTGTAATCCTGTATCAGTTTCCTATAATTTAAATGGAAAAAAACATCCTAATA
AAGGCTTTATTATTAACAGACCAGATAGTACCAGAAATTATGTGACTATATAAATATCAAAACG
TGTTCACTTTGTAGGACAAAATTATGTTGAAAGTTCTAGCTTAAGTGTTGGCACTTTTATGGGG
GGGAAATCAGTTTTAAAACTAAGACTTCCATGTATACCCAGTAATTTAAAATTATGTGAAATAT
TTTAAATTTGTGAACTCGTAATTACTATTTTAATGATTGAGCTTCTCGAGAATGGTAAGTGTAT
AGATGCTCTTGCGGTTTCTTTTCAGTAAGACGTGCCTGGAAACCATGGATCCCCTTTGTAAAAA
GACACTGTAGATAATTGAATGTTGATTATAGAAAGGCCATTAGTTTCTTGTTACACATTTTGTT
AGTCCAGTTTTTGTCGCTTATTGGGTTTAATATTGTTCTTGAAAATAGTCAATGCTATGTTATG
TATAACTTTTCTAATAAAAGTTGTGTTTCAAGCTGTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020872	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99200	(Get FASTA)	NCBI Sequence Viewer
	EDM16276	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006209
	ENSRNOP00000006209.7

RefSeq Acc Id:

NP_001020872 ⟸ NM_001025701

- UniProtKB:

Q4KLH7 (UniProtKB/TrEMBL), A0A8I6ANZ0 (UniProtKB/TrEMBL), F7EK71 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVV
RIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDID
VAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTSASNLL
LEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSETGVMLP
EQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKR
KRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNR
LLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREEQQPQPQQQQAQRDVIDEPI
IEEPSRLQDSVMEASRTNIEESAMPPPPPQGVKRKAGQVDPEPAIPPQQVEQMEIPPVELPPEE
PPNICQLIPELELLPEKEKEKEKEKEEEEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALA
KTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII

hide sequence

Ensembl Acc Id:

ENSRNOP00000006209 ⟸ ENSRNOT00000006209

Ensembl Acc Id:

ENSRNOP00000095133 ⟸ ENSRNOT00000116638

Protein Domains

Rad21/Rec8-like protein C-terminal eukaryotic Rad21/Rec8-like protein N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KLH7-F1-model_v2	AlphaFold	Q4KLH7	1-635	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695323

Promoter ID:

EPDNEW_R5848

Type:

initiation region

Name:

Rad21_1

Description:

RAD21 cohesin complex component

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	91,538,660 - 91,538,720	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1594529	AgrOrtholog
BioCyc Gene	G2FUF-33427	BioCyc
Ensembl Genes	ENSRNOG00000004420	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006209	ENTREZGENE
	ENSRNOT00000006209.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.580	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7384021	IMAGE-MGC_LOAD
InterPro	NXP1_M-like	UniProtKB/TrEMBL
	Rad21/Rec8-like	UniProtKB/TrEMBL
	Rad21/Rec8_C	UniProtKB/TrEMBL
	Rad21_Rec8_N	UniProtKB/TrEMBL
	ScpA-like_C	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:314949	UniProtKB/TrEMBL
MGC_CLONE	MGC:116373	IMAGE-MGC_LOAD
NCBI Gene	314949	ENTREZGENE
PANTHER	DOUBLE-STRAND-BREAK REPAIR PROTEIN RAD21 HOMOLOG	UniProtKB/TrEMBL
	PTHR12585	UniProtKB/TrEMBL
Pfam	Rad21_Rec8	UniProtKB/TrEMBL
	Rad21_Rec8_N	UniProtKB/TrEMBL
PhenoGen	Rad21	PhenoGen
RatGTEx	ENSRNOG00000004420	RatGTEx
Superfamily-SCOP	SSF46785	UniProtKB/TrEMBL
UniProt	A0A8I6ANZ0	ENTREZGENE, UniProtKB/TrEMBL
	F7EK71	ENTREZGENE, UniProtKB/TrEMBL
	Q4KLH7	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-01	Rad21	RAD21 cohesin complex component	Rad21	RAD21 homolog (S. pombe)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Rad21	RAD21 homolog (S. pombe)	MGC116373	similar to HR21spA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	MGC116373	similar to HR21spA			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)