Advanced Search (OLGA)

Gene: Gng13 (G protein subunit gamma 13) Rattus norvegicus

Analyze

Symbol:

Gng13

Name:

G protein subunit gamma 13

RGD ID:

1593806

Description:

Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to act upstream of or within phospholipase C-activating G protein-coupled receptor signaling pathway and sensory perception of taste. Predicted to be located in dendrite. Predicted to be part of heterotrimeric G-protein complex. Predicted to be active in synapse. Orthologous to human GNG13 (G protein subunit gamma 13); PARTICIPATES IN chemokine mediated signaling pathway; glutamate signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

guanine nucleotide binding protein (G protein), gamma 13; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13; heterotrimeric guanine nucleotide-binding protein 3j; Hg3j; LOC685451; similar to guanine nucleotide binding protein 13, gamma

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNG13 (G protein subunit gamma 13)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Gng13 (guanine nucleotide binding protein (G protein), gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gng13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNG13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNG13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gng13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNG13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNG13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gng13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gng13 (G protein subunit gamma 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNF213 (ring finger protein 213)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GNG13 (G protein subunit gamma 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNG13 (G protein subunit gamma 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gng13 (guanine nucleotide binding protein (G protein), gamma 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gng13 (guanine nucleotide binding protein (G protein), gamma 13)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng13b (guanine nucleotide binding protein (G protein), gamma 13b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gng13b (guanine nucleotide binding protein (G protein), gamma 13b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gpc-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ggamma30A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ggamma30A	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gng13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gng13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,245,698 - 15,247,602 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,245,698 - 15,247,602 (+)	Ensembl				GRCr8
mRatBN7.2	10	14,741,179 - 14,743,083 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	14,741,239 - 14,743,083 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	19,480,159 - 19,482,064 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	18,969,037 - 18,970,942 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,469,359 - 14,471,263 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	15,088,935 - 15,090,839 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,088,935 - 15,090,839 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	14,901,656 - 14,903,560 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	14,986,319 - 14,988,223 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	14,410,653 - 14,412,557 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4,5,3',4',5'-Hexachlorobiphenyl (EXP)

alpha-amanitin (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

endosulfan (EXP)

fenvalerate (EXP)

furan (EXP)

Licochalcone B (ISO)

maneb (ISO)

nitrogen dioxide (ISO)

ochratoxin A (EXP)

paraquat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

titanium dioxide (EXP,ISO)

toluene (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IEA)

phospholipase C-activating G protein-coupled receptor signaling pathway (IEA,ISO)

sensory perception of taste (IEA,ISO)

signal transduction (IEA)

Cellular Component

dendrite (IEA,ISO)

heterotrimeric G-protein complex (IEA,ISO)

plasma membrane (IEA)

synapse (IEA,ISO)

Molecular Function

G-protein beta-subunit binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

glutamate signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10570481	PMID:12454992	PMID:12606627	PMID:22871113

Genomics

Comparative Map Data

Gng13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	15,245,698 - 15,247,602 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	15,245,698 - 15,247,602 (+)	Ensembl				GRCr8
mRatBN7.2	10	14,741,179 - 14,743,083 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	14,741,239 - 14,743,083 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	19,480,159 - 19,482,064 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	18,969,037 - 18,970,942 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	14,469,359 - 14,471,263 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	15,088,935 - 15,090,839 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	15,088,935 - 15,090,839 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	14,901,656 - 14,903,560 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	14,986,319 - 14,988,223 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	14,410,653 - 14,412,557 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

GNG13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	798,041 - 800,734 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	798,041 - 800,734 (-)	Ensembl			hg38	GRCh38
GRCh37	16	848,041 - 850,734 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	788,042 - 790,734 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	788,042 - 790,700	NCBI
Celera	16	1,047,927 - 1,050,619 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	770,609 - 773,301 (-)	NCBI		HuRef
CHM1_1	16	847,980 - 850,672 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	802,865 - 805,558 (-)	NCBI		T2T-CHM13v2.0

Gng13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	25,936,146 - 25,938,076 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	25,936,145 - 25,938,380 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	25,717,172 - 25,719,102 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	25,717,171 - 25,719,406 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	25,854,117 - 25,856,047 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	25,444,824 - 25,446,685 (+)	NCBI		MGSCv36	mm8
Celera	17	26,249,474 - 26,251,404 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	12.82	NCBI

Gng13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	16,408,295 - 16,414,608 (+)	Ensembl
ChiLan1.0	NW_004955442	16,408,295 - 16,414,608 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNG13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	1,040,543 - 1,043,564 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	4,824,673 - 4,827,783 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	16	813,294 - 815,490 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	813,363 - 813,721 (-)	Ensembl			panPan2	panpan1.1

GNG13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	39,800,092 - 39,806,959 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	39,806,528 - 39,806,871 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	41,064,844 - 41,071,622 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	40,143,295 - 40,150,080 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	40,149,647 - 40,149,990 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	39,831,932 - 39,838,712 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	39,792,179 - 39,798,942 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	40,271,015 - 40,277,796 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gng13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	112,132,587 - 112,134,566 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	232,009 - 232,413 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936501	230,439 - 232,426 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNG13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	40,998,504 - 41,000,905 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	40,997,556 - 41,000,718 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	41,476,315 - 41,478,448 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNG13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666068	30,415,440 - 30,416,392 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gng13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624913	1,603,542 - 1,605,522 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624913	1,603,548 - 1,605,542 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gng13
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	2,982,589 - 2,984,547 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gng13
16 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	98
Count of miRNA genes:	86
Interacting mature miRNAs:	88
Transcripts:	ENSRNOT00000030273
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6661118	35509383	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5893811	50893811	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5893811	50893811	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6877142	51877142	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35730538	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	30004247	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5893811	50893811	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	922197	45922197	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	2103708	47103708	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5893811	50893811	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	1	17749933	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38832698	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	1	55	116	70	74	50	16	50	6	225	81	1	102	79	80	24	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006246034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ120504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030273 ⟹ ENSRNOP00000030270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	15,245,698 - 15,247,602 (+)	Ensembl
mRatBN7.2 Ensembl	10	14,741,239 - 14,743,083 (+)	Ensembl
Rnor_6.0 Ensembl	10	15,088,935 - 15,090,839 (+)	Ensembl

RefSeq Acc Id:

NM_001135918 ⟹ NP_001129390

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,245,698 - 15,247,602 (+)	NCBI
mRatBN7.2	10	14,741,179 - 14,743,083 (+)	NCBI
Rnor_6.0	10	15,088,935 - 15,090,839 (+)	NCBI
Rnor_5.0	10	14,901,656 - 14,903,560 (+)	NCBI
RGSC_v3.4	10	14,986,319 - 14,988,223 (+)	RGD
Celera	10	14,410,653 - 14,412,557 (+)	RGD

Sequence:

show sequence

TTCGGCCCTTGTCATCTCTGCTTTTGCTGTCTCCTTCAAAACCTCAGGCTGGCTACCTCCGACG
CCCCCGACGCCATGGAGGAGTGGGATGTGCCCCAGATGAAGAAGGAGGTGGAGAGCCTCAAGTA
CCAACTGGCCTTCAAGAGGGAGATGTCGTCCAAGACCATCCCCGAGCTCCTCAAGTGGATTGAG
GACGGGATCCCCAAGGACCCCTTCCTGAACCCGGACCTGATGAAGAACAACCCTTGGGTGGAGA
AGGCCAAGTGTACCATCCTCTGAGCCTGACCCGCACTCTCTGTTAAGGTGTGACTTTATAAACA
GACTTCTCCAGGAGTCTCTGCCCTGGTACATCCC

hide sequence

RefSeq Acc Id:

XM_006246034 ⟹ XP_006246096

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	15,245,888 - 15,247,596 (+)	NCBI
mRatBN7.2	10	14,741,393 - 14,743,083 (+)	NCBI
Rnor_6.0	10	15,089,174 - 15,090,833 (+)	NCBI
Rnor_5.0	10	14,901,656 - 14,903,560 (+)	NCBI

Sequence:

show sequence

CTGCGCCGTGCGCGCCGCCCGCAGTGCCCGTGTGCGCCGCCGTGCGCCTGGCCGGGGGCGTCTC
GGGGTGCACCGGTGGCCGGGCTCCGGCGGCGGCAGCAGCGCAGCCTCAGGCTGGCTACCTCCGA
CGCCCCCGACGCCATGGAGGAGTGGGATGTGCCCCAGATGAAGAAGGAGGTGGAGAGCCTCAAG
TACCAACTGGCCTTCAAGAGGGAGATGTCGTCCAAGACCATCCCCGAGCTCCTCAAGTGGATTG
AGGACGGGATCCCCAAGGACCCCTTCCTGAACCCGGACCTGATGAAGAACAACCCTTGGGTGGA
GAAGGCCAAGTGTACCATCCTCTGAGCCTGACCCGCACTCTCTGTTAAGGTGTGACTTTATAAA
CAGACTTCTCCAGGAGTCTCTGCCCTGGTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001129390	(Get FASTA)	NCBI Sequence Viewer
	XP_006246096	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAZ23842	(Get FASTA)	NCBI Sequence Viewer
	AAZ23843	(Get FASTA)	NCBI Sequence Viewer
	CAG9553628	(Get FASTA)	NCBI Sequence Viewer
	EDM03943	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030270
	ENSRNOP00000030270.6

RefSeq Acc Id:	NP_001129390 ⟸ NM_001135918
- UniProtKB:	A6HD38 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKAKC TIL hide sequence

RefSeq Acc Id:	XP_006246096 ⟸ XM_006246034
- Peptide Label:	isoform X1
- UniProtKB:	A6HD38 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEEWDVPQMKKEVESLKYQLAFKREMSSKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKAKC TIL hide sequence

Ensembl Acc Id:

ENSRNOP00000030270 ⟸ ENSRNOT00000030273

Protein Domains

G protein gamma

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8Y0-F1-model_v2	AlphaFold	G3V8Y0	1-67	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697053

Promoter ID:

EPDNEW_R7578

Type:

single initiation site

Name:

Gng13_1

Description:

G protein subunit gamma 13

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	15,088,922 - 15,088,982	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593806	AgrOrtholog
BioCyc Gene	G2FUF-25767	BioCyc
Ensembl Genes	ENSRNOG00000039350	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030273	ENTREZGENE
	ENSRNOT00000030273.6	UniProtKB/TrEMBL
Gene3D-CATH	4.10.260.10	UniProtKB/TrEMBL
InterPro	G-protein_gamma_dom	UniProtKB/TrEMBL
	GGL_sf	UniProtKB/TrEMBL
	GNG13	UniProtKB/TrEMBL
KEGG Report	rno:685451	UniProtKB/TrEMBL
NCBI Gene	685451	ENTREZGENE
PANTHER	GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)/G(S)/G(O) SUBUNIT GAMMA-13	UniProtKB/TrEMBL
	PTHR15936	UniProtKB/TrEMBL
Pfam	G-gamma	UniProtKB/TrEMBL
PhenoGen	Gng13	PhenoGen
PROSITE	G_PROTEIN_GAMMA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000039350	RatGTEx
SMART	G_gamma	UniProtKB/TrEMBL
	GGL	UniProtKB/TrEMBL
Superfamily-SCOP	G-protein_gamma-like	UniProtKB/TrEMBL
UniProt	A6HD38	ENTREZGENE, UniProtKB/TrEMBL
	G3V8Y0_RAT	UniProtKB/TrEMBL
	Q45QJ8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gng13	G protein subunit gamma 13	Gng13	guanine nucleotide binding protein (G protein), gamma 13	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Gng13	guanine nucleotide binding protein (G protein), gamma 13	LOC682159	similar to guanine nucleotide binding protein 13, gamma	Data merged from RGD:1586928	1643240	APPROVED
2008-03-05	Gng13	guanine nucleotide binding protein (G protein), gamma 13	LOC685451	similar to guanine nucleotide binding protein 13, gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC685451	similar to guanine nucleotide binding protein 13, gamma			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC682159	similar to guanine nucleotide binding protein 13, gamma			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)