Symbol:
Mr1
Name:
major histocompatibility complex, class I-related
RGD ID:
1593291
Description:
Predicted to enable T cell receptor binding activity and beta-2-microglobulin binding activity. Predicted to be involved in several processes, including T cell differentiation in thymus; defense response to Gram-positive bacterium; and positive regulation of T cell mediated cytotoxicity directed against tumor cell target. Predicted to act upstream of or within defense response to Gram-negative bacterium. Predicted to be located in endoplasmic reticulum membrane; endosome membrane; and plasma membrane. Predicted to be part of MHC class I protein complex. Predicted to be active in external side of plasma membrane and extracellular space. Orthologous to human MR1 (major histocompatibility complex, class I-related); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
histocompatibility-2 complex class 1-like sequence; Hlals; Hlals_mapped; major histocompatibility complex class I-related gene protein; MHC class I-like sequence; MHC class I-like sequence (mapped); MHC class I-related; MHC class I-related gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MR1 (major histocompatibility complex, class I-related)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Mr1 (major histocompatibility complex, class I-related)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
LOC102013688 (major histocompatibility complex class I-related gene protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100972084 (major histocompatibility complex class I-related gene protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MR1 (major histocompatibility complex, class I-related)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101972633 (major histocompatibility complex class I-related gene protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MR1 (major histocompatibility complex, class I-related)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
LOC101700189 (major histocompatibility complex class I-related gene protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MR1 (major histocompatibility complex, class I-related)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mr1 (major histocompatibility complex, class I-related)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mhc1lja (major histocompatibility complex class I LJA)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
mhc1uba (major histocompatibility complex class I UBA)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
mhc1lfa (major histocompatibility complex class I LFA)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
mhc1uka (major histocompatibility complex class I UKA)
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
mhc1ula (major histocompatibility complex class I ULA)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mhc1b-uda (provisional)
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
mhc1b2
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 69,850,420 - 69,868,302 (-) NCBI GRCr8 mRatBN7.2 13 67,298,362 - 67,317,985 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 67,299,585 - 67,317,970 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 69,885,111 - 69,903,051 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 71,198,901 - 71,216,775 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 68,459,561 - 68,477,314 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 72,771,992 - 72,789,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 72,771,984 - 72,789,841 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 77,707,537 - 77,725,396 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 70,089,637 - 70,107,384 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 67,175,718 - 67,193,248 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mr1 Rat (-)-alpha-phellandrene increases expression ISO MR1 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MR1 mRNA CTD PMID:25075043 Mr1 Rat (-)-demecolcine increases expression ISO MR1 (Homo sapiens) 6480464 Demecolcine results in increased expression of MR1 mRNA CTD PMID:23649840 Mr1 Rat 1,2-dimethylhydrazine increases expression ISO Mr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MR1 mRNA CTD PMID:22206623 Mr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO MR1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of MR1 mRNA CTD PMID:20106945 and PMID:21632981 Mr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MR1 mRNA CTD PMID:33387578 Mr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MR1 mRNA CTD PMID:25975270 Mr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MR1 mRNA CTD PMID:21570461 Mr1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Mr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of MR1 mRNA CTD PMID:26251327 Mr1 Rat 4,4'-sulfonyldiphenol increases expression ISO Mr1 (Mus musculus) 6480464 bisphenol S results in increased expression of MR1 mRNA CTD PMID:30951980 Mr1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Mr1 (Mus musculus) 6480464 bisphenol S results in decreased expression of MR1 mRNA CTD PMID:39298647 Mr1 Rat 5-fluorouracil increases expression ISO MR1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of MR1 mRNA CTD PMID:16101138 Mr1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MR1 mRNA CTD PMID:25825206 Mr1 Rat 7,12-dimethyltetraphene increases expression ISO MR1 (Homo sapiens) 6480464 9 more ... CTD PMID:21527772 Mr1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of MR1 mRNA CTD PMID:31881176 Mr1 Rat actinomycin D multiple interactions ISO MR1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MR1 mRNA CTD PMID:38460933 Mr1 Rat actinomycin D increases expression ISO MR1 (Homo sapiens) 6480464 Dactinomycin results in increased expression of MR1 mRNA CTD PMID:38460933 Mr1 Rat acyclovir affects expression ISO MR1 (Homo sapiens) 6480464 Acyclovir affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat aflatoxin B1 increases expression ISO MR1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of MR1 mRNA and Aflatoxin B1 results in increased expression of MR1 protein CTD PMID:21527772 more ... Mr1 Rat aflatoxin B1 increases methylation ISO MR1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of MR1 gene CTD PMID:27153756 Mr1 Rat aflatoxin B1 affects expression ISO MR1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of MR1 protein CTD PMID:20106945 Mr1 Rat all-trans-retinoic acid increases expression ISO MR1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MR1 mRNA CTD PMID:33167477 Mr1 Rat alpha-phellandrene increases expression ISO MR1 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of MR1 mRNA CTD PMID:25075043 Mr1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MR1 mRNA CTD PMID:35163327 Mr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of MR1 mRNA CTD PMID:16483693 Mr1 Rat antirheumatic drug decreases expression ISO MR1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of MR1 mRNA CTD PMID:24449571 Mr1 Rat aristolochic acid A increases expression ISO MR1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MR1 mRNA CTD PMID:33212167 Mr1 Rat arsane increases methylation ISO MR1 (Homo sapiens) 6480464 Arsenic results in increased methylation of MR1 gene CTD PMID:24525453 Mr1 Rat arsenic atom increases methylation ISO MR1 (Homo sapiens) 6480464 Arsenic results in increased methylation of MR1 gene CTD PMID:24525453 Mr1 Rat arsenous acid increases expression ISO MR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MR1 mRNA CTD PMID:22521957 Mr1 Rat benzo[a]pyrene increases expression ISO Mr1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MR1 mRNA CTD PMID:22228805 and PMID:27195522 Mr1 Rat benzo[a]pyrene decreases methylation ISO MR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of MR1 promoter CTD PMID:27901495 Mr1 Rat benzo[a]pyrene increases expression ISO MR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of MR1 mRNA CTD PMID:20106945 more ... Mr1 Rat benzo[a]pyrene diol epoxide I increases expression ISO MR1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Mr1 Rat bis(2-chloroethyl) sulfide increases expression ISO Mr1 (Mus musculus) 6480464 Mustard Gas results in increased expression of MR1 mRNA CTD PMID:15674844 Mr1 Rat bis(2-chloroethyl) sulfide increases expression ISO MR1 (Homo sapiens) 6480464 Mustard Gas results in increased expression of MR1 mRNA CTD PMID:25102026 Mr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MR1 mRNA CTD PMID:25181051 Mr1 Rat bisphenol A multiple interactions ISO MR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MR1 gene CTD PMID:31601247 Mr1 Rat bisphenol A decreases expression ISO MR1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of MR1 mRNA CTD PMID:29275510 Mr1 Rat bisphenol A increases expression ISO Mr1 (Mus musculus) 6480464 bisphenol A results in increased expression of MR1 mRNA CTD PMID:30951980 Mr1 Rat bisphenol F increases expression ISO Mr1 (Mus musculus) 6480464 bisphenol F results in increased expression of MR1 mRNA CTD PMID:30951980 Mr1 Rat bupropion affects expression ISO MR1 (Homo sapiens) 6480464 Bupropion affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat cadmium dichloride increases expression ISO MR1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of MR1 mRNA CTD PMID:38382870 Mr1 Rat camptothecin increases expression ISO MR1 (Homo sapiens) 6480464 Camptothecin results in increased expression of MR1 mRNA CTD PMID:38460933 Mr1 Rat cannabidiol multiple interactions ISO Mr1 (Mus musculus) 6480464 [lipopolysaccharide and E coli O55-B5 co-treated with Cannabidiol] results in decreased expression of MR1 mRNA CTD PMID:30742662 Mr1 Rat cannabidiol increases expression ISO Mr1 (Mus musculus) 6480464 Cannabidiol results in increased expression of MR1 mRNA CTD PMID:30742662 Mr1 Rat carbamazepine affects expression ISO MR1 (Homo sapiens) 6480464 Carbamazepine affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat CGP 52608 multiple interactions ISO MR1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MR1 gene] CTD PMID:28238834 Mr1 Rat cisplatin increases expression ISO MR1 (Homo sapiens) 6480464 Cisplatin results in increased expression of MR1 mRNA CTD PMID:27392435 and PMID:27594783 Mr1 Rat cisplatin multiple interactions ISO MR1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of MR1 mRNA CTD PMID:27392435 Mr1 Rat clozapine affects expression ISO MR1 (Homo sapiens) 6480464 Clozapine affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of MR1 mRNA CTD PMID:17898221 Mr1 Rat corosolic acid increases expression ISO MR1 (Homo sapiens) 6480464 corosolic acid results in increased expression of MR1 mRNA CTD PMID:37939859 Mr1 Rat cyclophosphamide increases expression ISO MR1 (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of MR1 mRNA CTD PMID:21527772 Mr1 Rat cyclosporin A decreases expression ISO MR1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of MR1 mRNA CTD PMID:20106945 Mr1 Rat DDE decreases expression ISO MR1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MR1 mRNA CTD PMID:38568856 Mr1 Rat diarsenic trioxide increases expression ISO MR1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of MR1 mRNA CTD PMID:22521957 Mr1 Rat dibutyl phthalate decreases expression ISO Mr1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MR1 mRNA CTD PMID:21266533 Mr1 Rat diclofenac affects expression ISO MR1 (Homo sapiens) 6480464 Diclofenac affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat dicrotophos decreases expression ISO MR1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of MR1 mRNA CTD PMID:28302478 Mr1 Rat doxorubicin decreases expression ISO MR1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MR1 mRNA CTD PMID:29803840 Mr1 Rat EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor affects expression ISO MR1 (Homo sapiens) 6480464 Angiotensin-Converting Enzyme Inhibitors affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat epoxiconazole decreases expression ISO Mr1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of MR1 mRNA CTD PMID:35436446 Mr1 Rat ethanol increases expression ISO Mr1 (Mus musculus) 6480464 Ethanol results in increased expression of MR1 mRNA CTD PMID:30319688 Mr1 Rat ethyl methanesulfonate increases expression ISO MR1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of MR1 mRNA CTD PMID:23649840 Mr1 Rat etoposide increases expression ISO MR1 (Homo sapiens) 6480464 Etoposide results in increased expression of MR1 mRNA CTD PMID:21527772 Mr1 Rat etoposide affects expression ISO MR1 (Homo sapiens) 6480464 Etoposide affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat formaldehyde increases expression ISO MR1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of MR1 mRNA CTD PMID:23649840 Mr1 Rat fulvestrant multiple interactions ISO MR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MR1 gene CTD PMID:31601247 Mr1 Rat gefitinib affects expression ISO MR1 (Homo sapiens) 6480464 gefitinib affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of MR1 mRNA CTD PMID:38314887 Mr1 Rat hydrochlorothiazide affects expression ISO MR1 (Homo sapiens) 6480464 Hydrochlorothiazide affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat ifosfamide affects expression ISO MR1 (Homo sapiens) 6480464 Ifosfamide affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat iopromide affects expression ISO MR1 (Homo sapiens) 6480464 iopromide affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat lincomycin affects expression ISO MR1 (Homo sapiens) 6480464 Lincomycin affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat mefenamic acid affects expression ISO MR1 (Homo sapiens) 6480464 Mefenamic Acid affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat methyl methanesulfonate increases expression ISO MR1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of MR1 mRNA CTD PMID:21527772 and PMID:23649840 Mr1 Rat minocycline affects expression ISO MR1 (Homo sapiens) 6480464 Minocycline affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat nickel atom increases expression ISO MR1 (Homo sapiens) 6480464 Nickel results in increased expression of MR1 mRNA CTD PMID:25583101 Mr1 Rat norfloxacin affects expression ISO MR1 (Homo sapiens) 6480464 Norfloxacin affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat Nutlin-3 multiple interactions ISO MR1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of MR1 mRNA CTD PMID:38460933 Mr1 Rat Nutlin-3 increases expression ISO MR1 (Homo sapiens) 6480464 nutlin 3 results in increased expression of MR1 mRNA CTD PMID:38460933 Mr1 Rat ozone decreases expression ISO Mr1 (Mus musculus) 6480464 Ozone results in decreased expression of MR1 mRNA CTD PMID:12763052 Mr1 Rat ozone multiple interactions ISO MR1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MR1 mRNA CTD PMID:35430440 Mr1 Rat paracetamol increases expression ISO MR1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MR1 mRNA CTD PMID:22230336 Mr1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MR1 mRNA CTD PMID:33387578 Mr1 Rat perfluorohexanesulfonic acid increases expression ISO Mr1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MR1 mRNA CTD PMID:37995155 Mr1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MR1 mRNA CTD PMID:35163327 Mr1 Rat phenobarbital increases expression ISO Mr1 (Mus musculus) 6480464 Phenobarbital results in increased expression of MR1 mRNA CTD PMID:19270015 Mr1 Rat piperacillin affects expression ISO MR1 (Homo sapiens) 6480464 Piperacillin affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat pirinixic acid decreases expression ISO Mr1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MR1 mRNA CTD PMID:20813756 Mr1 Rat pirinixic acid multiple interactions ISO Mr1 (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in decreased expression of MR1 mRNA CTD PMID:20813756 Mr1 Rat piroxicam affects expression ISO MR1 (Homo sapiens) 6480464 Piroxicam affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat propanal increases expression ISO MR1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of MR1 mRNA CTD PMID:26079696 Mr1 Rat quercetin increases expression ISO MR1 (Homo sapiens) 6480464 Quercetin results in increased expression of MR1 mRNA CTD PMID:21632981 Mr1 Rat raloxifene increases expression ISO MR1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of MR1 mRNA CTD PMID:19429434 Mr1 Rat Repaglinide affects expression ISO MR1 (Homo sapiens) 6480464 repaglinide affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat resveratrol increases expression ISO MR1 (Homo sapiens) 6480464 resveratrol results in increased expression of MR1 mRNA CTD PMID:25888808 Mr1 Rat rifampicin affects expression ISO MR1 (Homo sapiens) 6480464 Rifampin affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat rofecoxib affects expression ISO MR1 (Homo sapiens) 6480464 rofecoxib affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat silicon dioxide decreases expression ISO MR1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of MR1 mRNA CTD PMID:25895662 Mr1 Rat sodium arsenite increases expression ISO MR1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of MR1 mRNA CTD PMID:38568856 Mr1 Rat sulfasalazine affects expression ISO MR1 (Homo sapiens) 6480464 Sulfasalazine affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat tamoxifen increases expression ISO MR1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of MR1 mRNA CTD PMID:19429434 Mr1 Rat tetrachloromethane affects expression ISO Mr1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of MR1 mRNA CTD PMID:17484886 Mr1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of MR1 mRNA CTD PMID:33387578 Mr1 Rat triphenyl phosphate affects expression ISO MR1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MR1 mRNA CTD PMID:37042841 Mr1 Rat triptonide decreases expression ISO Mr1 (Mus musculus) 6480464 triptonide results in decreased expression of MR1 mRNA CTD PMID:33045310 Mr1 Rat trovafloxacin decreases expression ISO Mr1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of MR1 mRNA CTD PMID:35537566 Mr1 Rat urethane decreases expression ISO MR1 (Homo sapiens) 6480464 Urethane results in decreased expression of MR1 mRNA CTD PMID:28818685 Mr1 Rat valproic acid decreases expression ISO MR1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MR1 mRNA CTD PMID:29154799 Mr1 Rat vancomycin affects expression ISO MR1 (Homo sapiens) 6480464 Vancomycin affects the expression of MR1 mRNA CTD PMID:25811541 Mr1 Rat vincristine increases expression ISO MR1 (Homo sapiens) 6480464 Vincristine results in increased expression of MR1 mRNA CTD PMID:23649840 Mr1 Rat vitamin E decreases expression ISO MR1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of MR1 mRNA CTD PMID:19244175 Mr1 Rat zidovudine affects expression ISO MR1 (Homo sapiens) 6480464 Zidovudine affects the expression of MR1 mRNA CTD PMID:25811541
(-)-alpha-phellandrene (ISO) (-)-demecolcine (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) actinomycin D (ISO) acyclovir (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bupropion (ISO) cadmium dichloride (ISO) camptothecin (ISO) cannabidiol (ISO) carbamazepine (ISO) CGP 52608 (ISO) cisplatin (ISO) clozapine (ISO) cocaine (EXP) corosolic acid (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) DDE (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dicrotophos (ISO) doxorubicin (ISO) EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) etoposide (ISO) formaldehyde (ISO) fulvestrant (ISO) gefitinib (ISO) glyphosate (EXP) hydrochlorothiazide (ISO) ifosfamide (ISO) iopromide (ISO) lincomycin (ISO) mefenamic acid (ISO) methyl methanesulfonate (ISO) minocycline (ISO) nickel atom (ISO) norfloxacin (ISO) Nutlin-3 (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) piperacillin (ISO) pirinixic acid (ISO) piroxicam (ISO) propanal (ISO) quercetin (ISO) raloxifene (ISO) Repaglinide (ISO) resveratrol (ISO) rifampicin (ISO) rofecoxib (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfasalazine (ISO) tamoxifen (ISO) tetrachloromethane (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vancomycin (ISO) vincristine (ISO) vitamin E (ISO) zidovudine (ISO)
Mr1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 69,850,420 - 69,868,302 (-) NCBI GRCr8 mRatBN7.2 13 67,298,362 - 67,317,985 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 67,299,585 - 67,317,970 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 69,885,111 - 69,903,051 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 71,198,901 - 71,216,775 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 68,459,561 - 68,477,314 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 72,771,992 - 72,789,861 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 72,771,984 - 72,789,841 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 77,707,537 - 77,725,396 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 70,089,637 - 70,107,384 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 67,175,718 - 67,193,248 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
MR1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 181,033,387 - 181,061,938 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 181,033,374 - 181,061,938 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 181,002,523 - 181,031,074 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 179,269,762 - 179,291,256 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 177,734,795 - 177,756,290 NCBI Celera 1 154,109,484 - 154,137,989 (+) NCBI Celera Cytogenetic Map 1 q25.3 NCBI HuRef 1 152,233,302 - 152,261,856 (+) NCBI HuRef CHM1_1 1 182,425,213 - 182,453,711 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 180,388,622 - 180,417,159 (+) NCBI T2T-CHM13v2.0
Mr1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 155,003,620 - 155,022,560 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 155,003,023 - 155,022,560 (-) Ensembl GRCm39 Ensembl GRCm38 1 155,127,874 - 155,146,814 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 155,127,277 - 155,146,814 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 156,975,008 - 156,993,910 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 156,890,096 - 156,909,001 (-) NCBI MGSCv36 mm8 Celera 1 157,557,055 - 157,575,953 (-) NCBI Celera Cytogenetic Map 1 G3 NCBI cM Map 1 66.45 NCBI
LOC102013688 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955406 20,098,538 - 20,125,057 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955406 20,098,544 - 20,117,065 (+) NCBI ChiLan1.0 ChiLan1.0
LOC100972084 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 68,714,856 - 68,738,040 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 68,368,323 - 68,406,516 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 156,510,588 - 156,538,447 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 160,178,106 - 160,205,076 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 160,178,106 - 160,198,420 (+) Ensembl panpan1.1 panPan2
MR1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 14,521,735 - 14,531,296 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 14,099,261 - 14,106,689 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 14,247,973 - 14,255,396 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 7 14,159,221 - 14,166,661 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 14,265,642 - 14,273,072 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 14,389,587 - 14,397,005 (+) NCBI UU_Cfam_GSD_1.0
LOC101972633 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 90,479,169 - 90,501,203 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 8,327,690 - 8,347,960 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 8,325,918 - 8,347,941 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MR1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 122,592,532 - 122,609,022 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 122,592,510 - 122,611,462 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 134,628,625 - 134,642,871 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC101700189 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 169 Count of miRNA genes: 95 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000004694 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
89
88
57
25
57
6
216
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000004694 ⟹ ENSRNOP00000004694
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 67,300,103 - 67,317,970 (-) Ensembl Rnor_6.0 Ensembl 13 72,771,984 - 72,789,841 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103270 ⟹ ENSRNOP00000097744
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 67,299,585 - 67,317,966 (-) Ensembl
RefSeq Acc Id:
NM_001100635 ⟹ NP_001094105
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 69,850,420 - 69,868,166 (-) NCBI mRatBN7.2 13 67,300,103 - 67,317,850 (-) NCBI Rnor_6.0 13 72,771,992 - 72,789,738 (-) NCBI Rnor_5.0 13 77,707,537 - 77,725,396 (-) NCBI RGSC_v3.4 13 70,089,637 - 70,107,384 (-) RGD Celera 13 67,175,718 - 67,193,248 (-) RGD
Sequence:
ATGATGTTCCTGCTACCGTTCCTCACAGTATTTTTGGCGAAGCAAAGCCATACCCGGACCCACTCTCTGAGATACTTTCGTCTGGCTATTTCGGATCCTGGCCCTGGAGTCCCTGAATTTATCTCAGT TGGGTATGTGGACTCACACCCTATCACTACATACGACAGCGTCACCCGACAGAAGGAGCCAAGAGCCCCATGGATGGCGGAGAACCTGGCGCCTGACCACTGGGAGAGGTACACTCAGCTGCTAAGAG GCTGGCAGCGGACCTTCCAGACAGAGCTGAGGCACCTGCAGAGGCACTACAACCACTCAGGGCTTCACACCTACCAGAGAATGATCGGTTGTGAGTTGCTGGAAGACGGCAGCACCACAGGGTTTCTC CAGTATGCATATGATGGACAAGATTTCATTGTCTTCGATAAAGACACCCTCTCCTGGCTGGCTATGGATAATGTGGCTCACATCACCAAGCGAGCATGGGAGGCCAACCTGCATGAGTTGCAATACCA AAAGAACTGGCTAGAAGAAGAGTGCATTGCCTGGCTAAAGAGGTTCTTGGAGTATGGAAGTGATGCCCTAGAAAGAACAGAACATCCAGTAGTAAGAACAACTCGAAAGGAAACGTTTCCAGGGATTA CCACTCTCTTCTGCAGAGCTCATGGCTTCTACCCACCAGAAATTTCCATGATATGGAAGAAAAATGGGGAAGAAATTGTCCAGGAGGTGGATTATGGAGGGGTGCTTCCCAGTGGGGATGGAACCTAT CAAATGTGGGTGTCGGTTGATCTGGATCCTCAGACCAAAGACATTTATTCTTGTCATGTGGAGCACTGTGGTCTCCAAATGGTTCTGGAGGCCCCTCAGGAATCAGGAAACACCCTTCTAGTGGCAAA CACGATCTCTGGGACCATAATTCTCATCATTGTCCTGGCTGGAGTTGGTGCCCTGATCTGGAGAAGAAGGTCACGAGAACCAAAAGAAGTCATGTACCAACCCACCCAAGTCAATGAGGGCAGCTCTC CCTCTTAGGAGCCATGGTCTCTGCTCTCAGGCACCCACGTGTCTCAGCCAAACTCCTGACACGGGATTGTAGAATTGAGCATTTGTGACAAGAAGATAAGAGCTACAAATTTGTCTTCGTTCTTTGGC TCCAGAAGAACTGTCAATTTTTAGGCTCTTGATAGACTTAAAACATAGTTTGTCTCATGACCCAATACCTCCCAATATTATATTTCTCAATGGTGATAGATTAGAGTCTCAGAGCAGCAAGCAGCTTT CTCATCCAAGATGTTTTCTAAAATGTCACAGACTTGGCTCTTTTCTCTGCTCTCTTACCCTCTTCAACCTTTATCCCTTTTCTCCCCATTCCCTATCCCCCTTCCCTCCCGTGCTCATGGCTGGCCTT TACTTCTCCCCTCTTCTACTTTTCTCTCATTAAACCTTTCCACGTGG
hide sequence
RefSeq Acc Id:
XR_005492204
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 69,850,858 - 69,868,302 (-) NCBI mRatBN7.2 13 67,298,362 - 67,317,985 (-) NCBI
RefSeq Acc Id:
NP_001094105 ⟸ NM_001100635
- Peptide Label:
precursor
- UniProtKB:
O19477 (UniProtKB/Swiss-Prot), A0A0H2UHB9 (UniProtKB/TrEMBL), A6ICY4 (UniProtKB/TrEMBL)
- Sequence:
MMFLLPFLTVFLAKQSHTRTHSLRYFRLAISDPGPGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQRTFQTELRHLQRHYNHSGLHTYQRMIGCELLEDGSTTGFL QYAYDGQDFIVFDKDTLSWLAMDNVAHITKRAWEANLHELQYQKNWLEEECIAWLKRFLEYGSDALERTEHPVVRTTRKETFPGITTLFCRAHGFYPPEISMIWKKNGEEIVQEVDYGGVLPSGDGTY QMWVSVDLDPQTKDIYSCHVEHCGLQMVLEAPQESGNTLLVANTISGTIILIIVLAGVGALIWRRRSREPKEVMYQPTQVNEGSSPS
hide sequence
Ensembl Acc Id:
ENSRNOP00000004694 ⟸ ENSRNOT00000004694
Ensembl Acc Id:
ENSRNOP00000097744 ⟸ ENSRNOT00000103270
RGD ID: 13698904
Promoter ID: EPDNEW_R9429
Type: multiple initiation site
Name: Mr1_1
Description: major histocompatibility complex, class I-related
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 72,789,848 - 72,789,908 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Mr1
major histocompatibility complex, class I-related
Hlals
MHC class I-like sequence
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2007-04-13
MHC class I-like sequence
Hlals
MHC class I-like sequence (mapped)
Name updated
737654
APPROVED
2007-04-11
Hlals
MHC class I-like sequence (mapped)
Hlals_mapped
MHC class I-like sequence (mapped)
Data merged from RGD:2799
737654
APPROVED
2006-11-20
Hlals
MHC class I-like sequence (mapped)
Symbol and Name status set to provisional
70820
PROVISIONAL
2005-11-17
Hlals_mapped
MHC class I-like sequence (mapped)
Symbol and Name updated
1556543
APPROVED
2002-11-06
Hlals
MHC class I-like sequence
MHC class I-related gene
Name updated
625702
APPROVED
2002-06-10
Hlals
MHC class I-related gene
Symbol and Name status set to approved
70586
APPROVED
2001-06-12
Mr1
MHC class I-related gene
Symbol withdrawn, duplicate of Hlals (RGD:2799)
62408
WITHDRAWN
Note Type
Note
Reference
gene_domains
contains beta2-microglobulin and CD8 contact sites
1300055
gene_other
single copy gene
1300055