Advanced Search (OLGA)

Gene: Diaph3 (diaphanous-related formin 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Diaph3

Name:

diaphanous-related formin 3

RGD ID:

1593287

Description:

Predicted to enable actin binding activity; microtubule binding activity; and protein homodimerization activity. Involved in spermatogenesis. Predicted to be located in cytoplasm and nucleus. Predicted to be part of ESCRT I complex and filamentous actin. Predicted to be active in several cellular components, including cleavage furrow; cytoskeleton; and stereocilia tip-link density. Human ortholog(s) of this gene implicated in autosomal dominant auditory neuropathy 1. Orthologous to human DIAPH3 (diaphanous related formin 3); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Diap3; diaphanous homolog 3; diaphanous homolog 3 (Drosophila); DRF3; LOC290396; mDIA2; similar to Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (mDIA2) (p134mDIA2)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DIAPH3 (diaphanous related formin 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Diaph3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Diaph3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DIAPH3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DIAPH3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Diaph3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DIAPH3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DIAPH3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Diaph3 (diaphanous related formin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DIAPH2 (diaphanous related formin 2)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Diaph3 (diaphanous related formin 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DIAPH3 (diaphanous related formin 3)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	diaph3 (diaphanous-related formin 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyk-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	dia	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	diaph3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Diaph3^{Tn(sb-T2/Bart3)2.318Mcwi}

Genetic Models:

F344-Diaph3^{Tn(sb-T2/Bart3)2.318Mcwi}

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	68,951,992 - 69,421,623 (-)	NCBI		GRCr8
mRatBN7.2	15	62,543,375 - 63,013,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	62,543,375 - 63,012,975 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	66,656,922 - 67,116,561 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	67,742,429 - 68,202,078 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	64,634,100 - 65,103,658 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	69,928,507 - 70,400,077 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	70,039,424 - 70,399,924 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	73,538,942 - 74,007,617 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	68,905,784 - 69,267,707 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	62,058,201 - 62,525,728 (-)	NCBI		Celera
Cytogenetic Map	15	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	autosomal dominant auditory neuropathy 1		ISO	DIAPH3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:15520414 more ...
Diaph3	Rat	chromosome 13q14 deletion syndrome		ISO	DIAPH3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 13q14 deletion syndrome	ClinVar
Diaph3	Rat	Hearing Loss		ISO	DIAPH3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hearing impairment	ClinVar	PMID:25741868 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	autosomal dominant auditory neuropathy 1		ISO	DIAPH3 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	autosomal dominant auditory neuropathy 1		ISS	Diaph3 (Mus musculus)	13592920	OMIM:609129	MouseDO
Diaph3	Rat	congenital dyserythropoietic anemia		ISS	Diaph3 (Mus musculus)	13592920		MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	autosomal dominant auditory neuropathy 1		ISO	DIAPH3 (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of DIAPH3 mRNA	CTD	PMID:22079256
Diaph3	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of DIAPH3 mRNA	CTD	PMID:30723492
Diaph3	Rat	17alpha-ethynylestradiol	affects expression	ISO	Diaph3 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of DIAPH3 mRNA	CTD	PMID:17555576
Diaph3	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DIAPH3 mRNA	CTD	PMID:17942748
Diaph3	Rat	17alpha-ethynylestradiol	increases expression	ISO	Diaph3 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of DIAPH3 mRNA	CTD	PMID:17942748
Diaph3	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DIAPH3 mRNA	CTD	PMID:32741896
Diaph3	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of DIAPH3 mRNA	CTD	PMID:32145629
Diaph3	Rat	17beta-estradiol 3-benzoate	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DIAPH3 mRNA	CTD	PMID:32741896
Diaph3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	DIAPH3 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin affects the expression of DIAPH3 mRNA	CTD	PMID:22298810
Diaph3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DIAPH3 mRNA	CTD	PMID:34747641
Diaph3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of DIAPH3 mRNA	CTD	PMID:32109520
Diaph3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Diaph3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of DIAPH3 mRNA	CTD	PMID:21570461 and PMID:26377647
Diaph3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DIAPH3 mRNA	CTD	PMID:17942748
Diaph3	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Diaph3 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
Diaph3	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of DIAPH3 mRNA	CTD	PMID:28628672
Diaph3	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of DIAPH3 mRNA	CTD	PMID:28628672
Diaph3	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	DIAPH3 (Homo sapiens)	6480464	bisphenol S results in decreased methylation of DIAPH3 gene	CTD	PMID:31601247
Diaph3	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of DIAPH3 mRNA	CTD	PMID:24780913
Diaph3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of DIAPH3 mRNA	CTD	PMID:24780913 and PMID:25825206
Diaph3	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of DIAPH3 mRNA	CTD	PMID:31881176
Diaph3	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of DIAPH3 mRNA	CTD	PMID:28959563
Diaph3	Rat	aflatoxin B1	affects expression	ISO	DIAPH3 (Homo sapiens)	6480464	Aflatoxin B1 affects the expression of DIAPH3 protein	CTD	PMID:20106945
Diaph3	Rat	aflatoxin B1	decreases methylation	ISO	DIAPH3 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of DIAPH3 gene	CTD	PMID:27153756
Diaph3	Rat	aflatoxin B1	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of DIAPH3 mRNA	CTD	PMID:27153756
Diaph3	Rat	aldehydo-D-glucose	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DIAPH3 mRNA	CTD	PMID:37567420
Diaph3	Rat	all-trans-retinoic acid	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Tretinoin results in decreased expression of DIAPH3 mRNA	CTD	PMID:33167477
Diaph3	Rat	aristolochic acid A	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of DIAPH3 mRNA	CTD	PMID:33212167
Diaph3	Rat	arsenous acid	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of DIAPH3 mRNA	CTD	PMID:20458559
Diaph3	Rat	atrazine	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Atrazine results in increased expression of DIAPH3 mRNA	CTD	PMID:22378314
Diaph3	Rat	azathioprine	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Azathioprine results in decreased expression of DIAPH3 mRNA	CTD	PMID:22623647
Diaph3	Rat	benzo[a]pyrene	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of DIAPH3 mRNA and Benzo(a)pyrene results in decreased expression of DIAPH3 protein	CTD	PMID:20106945 more ...
Diaph3	Rat	benzo[a]pyrene	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of DIAPH3 mRNA	CTD	PMID:32234424
Diaph3	Rat	benzo[a]pyrene	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of DIAPH3 mRNA	CTD	PMID:15034205
Diaph3	Rat	benzo[a]pyrene	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of DIAPH3 mRNA]	CTD	PMID:15034205
Diaph3	Rat	benzo[a]pyrene	increases expression	ISO	Diaph3 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of DIAPH3 mRNA	CTD	PMID:32417428
Diaph3	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397 and PMID:20382639
Diaph3	Rat	benzo[b]fluoranthene	increases expression	ISO	Diaph3 (Mus musculus)	6480464	benzo(b)fluoranthene results in increased expression of DIAPH3 mRNA	CTD	PMID:26377693
Diaph3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DIAPH3 mRNA	CTD	PMID:25181051 and PMID:32145629
Diaph3	Rat	bisphenol A	increases methylation	ISO	DIAPH3 (Homo sapiens)	6480464	bisphenol A results in increased methylation of DIAPH3 gene	CTD	PMID:31601247
Diaph3	Rat	bisphenol A	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	bisphenol A results in decreased expression of DIAPH3 mRNA	CTD	PMID:29275510
Diaph3	Rat	caffeine	decreases phosphorylation	ISO	DIAPH3 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of DIAPH3 protein	CTD	PMID:35688186
Diaph3	Rat	calcitriol	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Calcitriol results in decreased expression of DIAPH3 mRNA	CTD	PMID:21592394
Diaph3	Rat	calcitriol	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of DIAPH3 mRNA	CTD	PMID:21592394
Diaph3	Rat	carbon nanotube	increases expression	ISO	Diaph3 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Diaph3	Rat	chlorpyrifos	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of DIAPH3 mRNA	CTD	PMID:37019170
Diaph3	Rat	chromium(6+)	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	chromium hexavalent ion results in decreased expression of DIAPH3 mRNA	CTD	PMID:30690063
Diaph3	Rat	chromium(6+)	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of DIAPH3 mRNA	CTD	PMID:38479592
Diaph3	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of DIAPH3 mRNA	CTD	PMID:22023808
Diaph3	Rat	cisplatin	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of DIAPH3 mRNA	CTD	PMID:27392435
Diaph3	Rat	cisplatin	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Cisplatin results in decreased expression of DIAPH3 mRNA	CTD	PMID:27392435
Diaph3	Rat	copper(II) sulfate	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of DIAPH3 mRNA	CTD	PMID:19549813
Diaph3	Rat	coumestrol	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 more ...	CTD	PMID:19167446
Diaph3	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of DIAPH3 mRNA	CTD	PMID:26577399
Diaph3	Rat	cyclosporin A	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Cyclosporine results in increased expression of DIAPH3 mRNA	CTD	PMID:25562108
Diaph3	Rat	cyclosporin A	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of DIAPH3 mRNA	CTD	PMID:27989131
Diaph3	Rat	D-glucose	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DIAPH3 mRNA	CTD	PMID:37567420
Diaph3	Rat	DDE	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of DIAPH3 mRNA	CTD	PMID:38568856
Diaph3	Rat	dexamethasone	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of DIAPH3 mRNA	CTD	PMID:28628672
Diaph3	Rat	diarsenic trioxide	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of DIAPH3 mRNA	CTD	PMID:20458559
Diaph3	Rat	dioxygen	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DIAPH3 mRNA	CTD	PMID:30529165
Diaph3	Rat	dioxygen	multiple interactions	EXP		6480464	[dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of DIAPH3 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of DIAPH3 mRNA	CTD	PMID:33729688
Diaph3	Rat	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of DIAPH3 mRNA	CTD	PMID:32289291
Diaph3	Rat	Enterolactone	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of DIAPH3 mRNA	CTD	PMID:19167446
Diaph3	Rat	enzyme inhibitor	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of DIAPH3 protein	CTD	PMID:23301498
Diaph3	Rat	epoxiconazole	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	epoxiconazole results in decreased expression of DIAPH3 mRNA	CTD	PMID:35436446
Diaph3	Rat	ethyl methanesulfonate	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of DIAPH3 mRNA	CTD	PMID:23649840
Diaph3	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of DIAPH3 mRNA	CTD	PMID:30307764
Diaph3	Rat	formaldehyde	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Formaldehyde results in decreased expression of DIAPH3 mRNA	CTD	PMID:23649840
Diaph3	Rat	FR900359	decreases phosphorylation	ISO	DIAPH3 (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of DIAPH3 protein	CTD	PMID:37730182
Diaph3	Rat	fructose	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DIAPH3 mRNA	CTD	PMID:37567420
Diaph3	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of DIAPH3 mRNA	CTD	PMID:33387578
Diaph3	Rat	glucose	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of DIAPH3 mRNA	CTD	PMID:37567420
Diaph3	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of DIAPH3 mRNA	CTD	PMID:22129741
Diaph3	Rat	indometacin	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of DIAPH3 mRNA	CTD	PMID:28628672
Diaph3	Rat	leflunomide	increases expression	ISO	Diaph3 (Mus musculus)	6480464	leflunomide results in increased expression of DIAPH3 mRNA	CTD	PMID:19751817
Diaph3	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of DIAPH3 mRNA	CTD	PMID:35283115
Diaph3	Rat	lucanthone	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Lucanthone results in decreased expression of DIAPH3 mRNA	CTD	PMID:21148553
Diaph3	Rat	MeIQx	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	2-amino-3 more ...	CTD	PMID:20816883
Diaph3	Rat	methamphetamine	decreases expression	EXP		6480464	Methamphetamine results in decreased expression of DIAPH3 mRNA	CTD	PMID:28341135
Diaph3	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of DIAPH3 mRNA	CTD	PMID:30467583
Diaph3	Rat	methotrexate	affects expression	ISO	Diaph3 (Mus musculus)	6480464	Methotrexate affects the expression of DIAPH3 mRNA	CTD	PMID:18502557
Diaph3	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of DIAPH3 gene	CTD	PMID:35440735
Diaph3	Rat	methyl methanesulfonate	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of DIAPH3 mRNA	CTD	PMID:23649840
Diaph3	Rat	methylmercury chloride	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of DIAPH3 mRNA	CTD	PMID:28001369
Diaph3	Rat	N-methyl-4-phenylpyridinium	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in decreased expression of DIAPH3 mRNA	CTD	PMID:24810058
Diaph3	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of DIAPH3 mRNA	CTD	PMID:22129741
Diaph3	Rat	N-Nitrosopyrrolidine	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	N-Nitrosopyrrolidine results in decreased expression of DIAPH3 mRNA	CTD	PMID:32234424
Diaph3	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of DIAPH3 mRNA	CTD	PMID:33484710
Diaph3	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of DIAPH3 mRNA	CTD	PMID:25729387
Diaph3	Rat	oxaliplatin	decreases expression	EXP		6480464	oxaliplatin results in decreased expression of DIAPH3 mRNA	CTD	PMID:25729387
Diaph3	Rat	ozone	multiple interactions	ISO	Diaph3 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of DIAPH3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of DIAPH3 mRNA	CTD	PMID:34911549
Diaph3	Rat	paracetamol	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Acetaminophen results in increased expression of DIAPH3 mRNA	CTD	PMID:22230336
Diaph3	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of DIAPH3 mRNA	CTD	PMID:33387578
Diaph3	Rat	paracetamol	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of DIAPH3 mRNA	CTD	PMID:29067470
Diaph3	Rat	phenformin	decreases expression	EXP		6480464	Phenformin results in decreased expression of DIAPH3 mRNA	CTD	PMID:31324951
Diaph3	Rat	PhIP	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of DIAPH3 mRNA	CTD	PMID:20816883
Diaph3	Rat	pirinixic acid	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	pirinixic acid results in decreased expression of DIAPH3 mRNA	CTD	PMID:20813756
Diaph3	Rat	potassium chromate	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of DIAPH3 mRNA	CTD	PMID:22079256
Diaph3	Rat	potassium chromate	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of DIAPH3 mRNA	CTD	PMID:22079256 and PMID:22714537
Diaph3	Rat	potassium dichromate	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Potassium Dichromate results in decreased expression of DIAPH3 protein	CTD	PMID:23718831
Diaph3	Rat	progesterone	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Progesterone results in decreased expression of DIAPH3 mRNA	CTD	PMID:21795739
Diaph3	Rat	propanal	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	propionaldehyde results in decreased expression of DIAPH3 mRNA	CTD	PMID:26079696
Diaph3	Rat	resveratrol	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Coumestrol co-treated with resveratrol] results in increased expression of DIAPH3 mRNA	CTD	PMID:19167446
Diaph3	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of DIAPH3 mRNA	CTD	PMID:28374803
Diaph3	Rat	senecionine	increases expression	EXP		6480464	senecionine results in increased expression of DIAPH3 mRNA	CTD	PMID:32419051
Diaph3	Rat	Senkirkine	increases expression	EXP		6480464	senkirkine results in increased expression of DIAPH3 mRNA	CTD	PMID:32419051
Diaph3	Rat	silicon dioxide	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of DIAPH3 mRNA	CTD	PMID:23806026 and PMID:25895662
Diaph3	Rat	sodium arsenite	decreases methylation	ISO	Diaph3 (Mus musculus)	6480464	sodium arsenite results in decreased methylation of DIAPH3 gene	CTD	PMID:32068019
Diaph3	Rat	sodium arsenite	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	sodium arsenite results in decreased expression of DIAPH3 mRNA	CTD	PMID:37682722
Diaph3	Rat	sodium arsenite	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	sodium arsenite results in increased expression of DIAPH3 mRNA	CTD	PMID:29301061
Diaph3	Rat	sunitinib	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Sunitinib results in decreased expression of DIAPH3 mRNA	CTD	PMID:31533062
Diaph3	Rat	tamoxifen	affects expression	ISO	Diaph3 (Mus musculus)	6480464	Tamoxifen affects the expression of DIAPH3 mRNA	CTD	PMID:17555576
Diaph3	Rat	temozolomide	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Temozolomide results in increased expression of DIAPH3 mRNA	CTD	PMID:31758290
Diaph3	Rat	testosterone	multiple interactions	ISO	DIAPH3 (Homo sapiens)	6480464	[Testosterone co-treated with Calcitriol] results in decreased expression of DIAPH3 mRNA	CTD	PMID:21592394
Diaph3	Rat	testosterone	multiple interactions	EXP		6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of DIAPH3 mRNA	CTD	PMID:32741896
Diaph3	Rat	testosterone	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Testosterone results in decreased expression of DIAPH3 mRNA	CTD	PMID:21592394
Diaph3	Rat	tetrachloromethane	increases expression	ISO	Diaph3 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of DIAPH3 mRNA	CTD	PMID:17484886 and PMID:31919559
Diaph3	Rat	thapsigargin	increases expression	ISO	Diaph3 (Mus musculus)	6480464	Thapsigargin results in increased expression of DIAPH3 protein	CTD	PMID:24648495
Diaph3	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DIAPH3 mRNA	CTD	PMID:23411599 and PMID:34492290
Diaph3	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of DIAPH3 mRNA	CTD	PMID:30012374
Diaph3	Rat	titanium dioxide	decreases methylation	ISO	Diaph3 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of DIAPH3 gene and titanium dioxide results in decreased methylation of DIAPH3 promoter	CTD	PMID:35295148
Diaph3	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of DIAPH3 mRNA	CTD	PMID:25729387
Diaph3	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of DIAPH3 mRNA	CTD	PMID:25729387
Diaph3	Rat	trimellitic anhydride	increases expression	ISO	Diaph3 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of DIAPH3 mRNA	CTD	PMID:19042947
Diaph3	Rat	troglitazone	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	troglitazone results in decreased expression of DIAPH3 mRNA	CTD	PMID:19140230
Diaph3	Rat	trovafloxacin	decreases expression	ISO	Diaph3 (Mus musculus)	6480464	trovafloxacin results in decreased expression of DIAPH3 mRNA	CTD	PMID:35537566
Diaph3	Rat	urethane	increases expression	ISO	DIAPH3 (Homo sapiens)	6480464	Urethane results in increased expression of DIAPH3 mRNA	CTD	PMID:28818685
Diaph3	Rat	valproic acid	decreases methylation	ISO	DIAPH3 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of DIAPH3 gene	CTD	PMID:29154799
Diaph3	Rat	valproic acid	affects expression	ISO	DIAPH3 (Homo sapiens)	6480464	Valproic Acid affects the expression of DIAPH3 mRNA	CTD	PMID:25979313
Diaph3	Rat	zoledronic acid	decreases expression	ISO	DIAPH3 (Homo sapiens)	6480464	zoledronic acid results in decreased expression of DIAPH3 mRNA	CTD	PMID:24714768

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	actin crosslink formation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin crosslink formation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:18835565	RGD	PMID:18835565
Diaph3	Rat	actin cytoskeleton organization	involved_in	ISS	UniProtKB:Q9Z207	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Diaph3	Rat	actin cytoskeleton organization	involved_in	IEA	InterPro:IPR010473	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Diaph3	Rat	actin cytoskeleton organization	involved_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin cytoskeleton organization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:33036023	RGD	PMID:33036023
Diaph3	Rat	actin cytoskeleton organization	involved_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:23558171	RGD	PMID:23558171
Diaph3	Rat	actin filament bundle assembly	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	MGI:5574347 PMID:18264091 and PMID:24239357	RGD	PMID:18264091 and PMID:24239357
Diaph3	Rat	actin filament bundle assembly	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin filament organization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:28255013	RGD	PMID:28255013
Diaph3	Rat	actin filament organization	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin filament polymerization	involved_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin filament polymerization	involved_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:23558171	RGD	PMID:23558171
Diaph3	Rat	actin filament polymerization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:23034183 and PMID:33036023	RGD	PMID:23034183 and PMID:33036023
Diaph3	Rat	actin filament polymerization	involved_in	IBA	MGI:1194490 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Diaph3	Rat	actin filament polymerization	involved_in	ISS	UniProtKB:Q9Z207	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Diaph3	Rat	actin nucleation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:21278336	RGD	PMID:21278336
Diaph3	Rat	actin nucleation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	autophagosome-lysosome fusion	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:33036023	RGD	PMID:33036023
Diaph3	Rat	autophagosome-lysosome fusion	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	cell projection organization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:23441200	RGD	PMID:23441200
Diaph3	Rat	cell projection organization	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	chromosome segregation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:27848932	RGD	PMID:27848932
Diaph3	Rat	chromosome segregation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	cytoskeleton organization	involved_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:23558171	RGD	PMID:23558171
Diaph3	Rat	cytoskeleton organization	involved_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	cytoskeleton organization	involved_in	ISS	UniProtKB:Q9Z207	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Diaph3	Rat	endosomal transport	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:33036023	RGD	PMID:33036023
Diaph3	Rat	endosomal transport	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	erythrocyte differentiation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:26471482 and PMID:33036023	RGD	PMID:26471482 and PMID:33036023
Diaph3	Rat	erythrocyte differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	erythrocyte enucleation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	erythrocyte enucleation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:18264091 and PMID:28255013	RGD	PMID:18264091 and PMID:28255013
Diaph3	Rat	establishment of cell polarity	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:32576838	RGD	PMID:32576838
Diaph3	Rat	establishment of cell polarity	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	gene expression	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:21278336 more ...	RGD	PMID:21278336 more ...
Diaph3	Rat	gene expression	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	head development	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:27848932	RGD	PMID:27848932
Diaph3	Rat	head development	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	in utero embryonic development	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	MGI:5574347 PMID:24239357	RGD	PMID:24239357
Diaph3	Rat	in utero embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	inner ear receptor cell differentiation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:23441200	RGD	PMID:23441200
Diaph3	Rat	inner ear receptor cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	integrin-mediated signaling pathway	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:32576838	RGD	PMID:32576838
Diaph3	Rat	integrin-mediated signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	macrophage differentiation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:26471482	RGD	PMID:26471482
Diaph3	Rat	macrophage differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule cytoskeleton organization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:24069443	RGD	PMID:24069443
Diaph3	Rat	microtubule cytoskeleton organization	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule polymerization	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule polymerization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:18458159 and PMID:24069443	RGD	PMID:18458159 and PMID:24069443
Diaph3	Rat	negative regulation of microtubule depolymerization	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:18458159	RGD	PMID:18458159
Diaph3	Rat	negative regulation of microtubule depolymerization	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	neuron differentiation	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:27848932	RGD	PMID:27848932
Diaph3	Rat	neuron differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	podosome assembly	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:15976449	RGD	PMID:15976449
Diaph3	Rat	podosome assembly	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	protein-containing complex remodeling	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	protein-containing complex remodeling	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:33036023	RGD	PMID:33036023
Diaph3	Rat	regulation of deacetylase activity	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:15976449	RGD	PMID:15976449
Diaph3	Rat	sensory perception of sound	acts_upstream_of_or_within	ISO	Diaph3 (Mus musculus)	1624291	PMID:23441200	RGD	PMID:23441200
Diaph3	Rat	sensory perception of sound	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	spermatogenesis		IEP		2314388		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	actin filament	is_active_in	IBA	MGI:1927222 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Diaph3	Rat	actin filament bundle	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin filament bundle	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:16556604	RGD	PMID:16556604
Diaph3	Rat	cleavage furrow	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	cleavage furrow	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:20660154	RGD	PMID:20660154
Diaph3	Rat	cytoplasm	located_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:19117945 and PMID:23558171	RGD	PMID:19117945 and PMID:23558171
Diaph3	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Diaph3	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Diaph3	Rat	ESCRT I complex	part_of	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	ESCRT I complex	part_of	ISO	Diaph3 (Mus musculus)	1624291	PMID:33036023	RGD	PMID:33036023
Diaph3	Rat	filamentous actin	part_of	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	filamentous actin	part_of	ISO	Diaph3 (Mus musculus)	1624291	PMID:18835565	RGD	PMID:18835565
Diaph3	Rat	microtubule organizing center	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule organizing center	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:24069443	RGD	PMID:24069443
Diaph3	Rat	nucleus	located_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Diaph3	Rat	nucleus	located_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:19117945 and PMID:23558171	RGD	PMID:19117945 and PMID:23558171
Diaph3	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Diaph3	Rat	ribbon synapse	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:23441200	RGD	PMID:23441200
Diaph3	Rat	ribbon synapse	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	spindle pole	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:24069443	RGD	PMID:24069443
Diaph3	Rat	spindle pole	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	stereocilia tip-link density	is_active_in	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	stereocilia tip-link density	is_active_in	ISO	Diaph3 (Mus musculus)	1624291	PMID:23441200	RGD	PMID:23441200

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Diaph3	Rat	actin binding	enables	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	actin binding	enables	IEA	InterPro:IPR010472 and InterPro:IPR010473	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Diaph3	Rat	actin binding	enables	ISO	Diaph3 (Mus musculus)	1624291	PMID:16556604	RGD	PMID:16556604
Diaph3	Rat	cytoskeletal protein binding	enables	ISO	Diaph3 (Mus musculus)	1624291	PMID:16556604	RGD	PMID:16556604
Diaph3	Rat	cytoskeletal protein binding	enables	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule binding	enables	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	microtubule binding	enables	ISO	Diaph3 (Mus musculus)	1624291	PMID:18458159	RGD	PMID:18458159
Diaph3	Rat	protein binding	enables	ISO	Diaph3 (Mus musculus)	1624291	UniProtKB:O22806 more ...	RGD	PMID:15976449 more ...
Diaph3	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q9Z207 and ensembl:ENSMUSP00000129420	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Diaph3	Rat	protein homodimerization activity	enables	ISO	Diaph3 (Mus musculus)	1624291	PMID:16556604 and PMID:18458159	RGD	PMID:16556604 and PMID:18458159
Diaph3	Rat	small GTPase binding	enables	IEA	InterPro:IPR010473	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Expression of the diaphanous-related formin proteins mDia1 and mDia2 in the rat testis.	Mironova E and Millette CF, Dev Dyn. 2008 Aug;237(8):2170-6.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:19117945	PMID:20624953	PMID:23558171	PMID:25468996

Diaph3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	68,951,992 - 69,421,623 (-)	NCBI		GRCr8
mRatBN7.2	15	62,543,375 - 63,013,060 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	62,543,375 - 63,012,975 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	66,656,922 - 67,116,561 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	67,742,429 - 68,202,078 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	64,634,100 - 65,103,658 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	69,928,507 - 70,400,077 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	70,039,424 - 70,399,924 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	73,538,942 - 74,007,617 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	68,905,784 - 69,267,707 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	62,058,201 - 62,525,728 (-)	NCBI		Celera
Cytogenetic Map	15	q12	NCBI

DIAPH3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	59,665,583 - 60,163,928 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	59,665,583 - 60,163,928 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	60,239,717 - 60,738,062 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	59,137,718 - 59,636,120 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	59,246,300 - 59,485,300	NCBI
Celera	13	41,197,875 - 41,696,297 (-)	NCBI		Celera
Cytogenetic Map	13	q21.2	NCBI
HuRef	13	41,255,633 - 41,428,315 (-)	NCBI		HuRef
HuRef	13	40,931,297 - 41,246,568 (-)	NCBI		HuRef
CHM1_1	13	60,207,261 - 60,705,825 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	58,885,077 - 59,383,567 (-)	NCBI		T2T-CHM13v2.0

Diaph3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	86,892,793 - 87,378,683 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	86,892,803 - 87,378,671 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	86,655,357 - 87,141,247 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	86,655,367 - 87,141,235 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	87,056,130 - 87,540,921 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	85,488,070 - 85,972,861 (-)	NCBI		MGSCv36	mm8
Celera	14	84,160,281 - 84,666,148 (-)	NCBI		Celera
Cytogenetic Map	14	E1	NCBI
cM Map	14	43.95	NCBI

Diaph3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	44,653,501 - 45,105,966 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	44,653,308 - 45,106,943 (+)	NCBI	ChiLan1.0	ChiLan1.0

DIAPH3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	61,191,418 - 61,681,129 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	59,783,100 - 60,272,789 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	40,846,270 - 41,335,920 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	59,568,025 - 60,056,893 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	59,676,307 - 60,056,672 (-)	Ensembl	panpan1.1		panPan2

DIAPH3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	15,573,485 - 16,078,580 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	15,573,629 - 16,079,031 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	15,549,820 - 16,056,525 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	15,808,339 - 16,315,836 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	15,808,334 - 16,315,281 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	15,507,946 - 16,015,886 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	15,533,302 - 16,040,579 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	15,547,618 - 16,055,719 (-)	NCBI		UU_Cfam_GSD_1.0

Diaph3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	144,087,524 - 144,542,722 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936705	1,380,445 - 1,731,280 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936705	1,381,025 - 1,833,890 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DIAPH3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	32,492,740 - 32,994,844 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	32,492,735 - 32,994,854 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	34,600,374 - 34,681,530 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DIAPH3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	37,455,326 - 37,951,237 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666057	5,747,366 - 6,261,536 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Diaph3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624748	21,045,085 - 21,383,605 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624748	20,937,242 - 21,439,554 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Diaph3
1910 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	20
Count of miRNA genes:	19
Interacting mature miRNAs:	20
Transcripts:	ENSRNOT00000012167
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
1576315	Schws6	Schwannoma susceptibility QTL 6		0.0069	nervous system integrity trait (VT:0010566)	post-insult time of death (CMO:0002005)	15	53806152	98806152	Rat
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
61477	Aia4	Adjuvant induced arthritis QTL 4	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	15	55596089	91365858	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	27885774	86257085	Rat
724545	Niddm54	Non-insulin dependent diabetes mellitus QTL 54		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	50794494	73699215	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	58156477	101769107	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
2293686	Bmd36	Bone mineral density QTL 36	7.4	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	15	33611058	71477291	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	34054139	79054139	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
631516	Gluco31	Glucose level QTL 31	7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	55596089	95018120	Rat
2293691	Bmd37	Bone mineral density QTL 37	6.6	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	15	33611058	71477291	Rat
2317050	Aia24	Adjuvant induced arthritis QTL 24	2.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	52847908	73690657	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
2313080	Bss65	Bone structure and strength QTL 65	3.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	15	60990468	73690657	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat

D15Rat125

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	62,725,486 - 62,725,621 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	70,113,265 - 70,113,399	NCBI	Rnor6.0
Rnor_5.0	15	73,722,226 - 73,722,360	UniSTS	Rnor5.0
RGSC_v3.4	15	68,977,804 - 68,977,939	RGD	RGSC3.4
RGSC_v3.4	15	68,977,805 - 68,977,939	UniSTS	RGSC3.4
RGSC_v3.1	15	68,993,584 - 68,993,719	RGD
Celera	15	62,240,269 - 62,240,403	UniSTS
SHRSP x BN Map	15	40.2698	RGD
SHRSP x BN Map	15	40.2698	UniSTS
Cytogenetic Map	15	q12	UniSTS

D15Rat150

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,990,914 - 68,991,125 (+)	Marker Load Pipeline
Celera	15	62,096,879 - 62,097,089	UniSTS
RH 3.4 Map	15	388.63	UniSTS
RH 3.4 Map	15	388.63	RGD
SHRSP x BN Map	15	39.1899	RGD
SHRSP x BN Map	15	39.1899	UniSTS
Cytogenetic Map	15	q12	UniSTS

D15Got225

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	62,594,641 - 62,594,908 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	69,980,584 - 69,980,850	NCBI	Rnor6.0
Rnor_5.0	15	73,591,185 - 73,591,451	UniSTS	Rnor5.0
RGSC_v3.4	15	68,846,714 - 68,846,980	UniSTS	RGSC3.4
Celera	15	62,109,148 - 62,109,414	UniSTS
Cytogenetic Map	15	q12	UniSTS

RH137283

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	62,543,430 - 62,543,642 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	69,928,560 - 69,928,771	NCBI	Rnor6.0
Rnor_5.0	15	73,538,995 - 73,539,206	UniSTS	Rnor5.0
RGSC_v3.4	15	68,795,219 - 68,795,430	UniSTS	RGSC3.4
RGSC_v3.4	15	68,587,986 - 68,588,197	UniSTS	RGSC3.4
Celera	15	62,058,254 - 62,058,465	UniSTS
RH 3.4 Map	15	388.63	UniSTS
Cytogenetic Map	15	q12	UniSTS

UniSTS:237232

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	62,543,460 - 62,543,658 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	69,928,590 - 69,928,787	NCBI	Rnor6.0
Rnor_5.0	15	73,539,025 - 73,539,222	UniSTS	Rnor5.0
RGSC_v3.4	15	68,587,970 - 68,588,167	UniSTS	RGSC3.4
RGSC_v3.4	15	68,795,249 - 68,795,446	UniSTS	RGSC3.4
Celera	15	62,058,284 - 62,058,481	UniSTS
Cytogenetic Map	15	q12	UniSTS

This gene Diaph3 is modified in the following models/strains:

F344-Diaph3^{Tn(sb-T2/Bart3)2.318Mcwi}

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001305172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012167 ⟹ ENSRNOP00000012167

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	62,543,378 - 63,012,975 (-)	Ensembl
Rnor_6.0 Ensembl	15	70,039,424 - 70,349,983 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087940 ⟹ ENSRNOP00000074783

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	70,349,804 - 70,399,924 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103316 ⟹ ENSRNOP00000082597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	62,543,375 - 62,608,052 (-)	Ensembl

RefSeq Acc Id:

NM_001305172 ⟹ NP_001292101

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,421,552 (-)	NCBI
mRatBN7.2	15	62,543,378 - 63,012,975 (-)	NCBI
Rnor_6.0	15	69,928,507 - 70,399,988 (-)	NCBI
Celera	15	62,058,201 - 62,525,728 (-)	NCBI

Sequence:

show sequence

GGGACCCGGAAGGTGAGTCTGCCGAGCATAGCCCCAGATCAGGTCGCGACCGAGACCCGGGAAGATGGAGAAGCATCGGGCGCGCGCTCTCGGCCGGGACAGCAAGGCTTCGCGGAGGAAGGGCCTGC
CGTCCGCGCCGCCCGCTGGCCCCTACGAACTCGGGGAGAAGCGCCCCAAGTTGCATTTAAATATTAGGACGCTGACAGATGATATGCTGGACAAATTTGCCAGCATAAGAATTCCGAAAGGGAGCAAG
AAAGAGCGACCTCCTCTTCCCCAGCTGAAGACTGTGTCTGGAAGCAGTGACTACTCGTCAGTGTCTTCAGAGACAATGGAAAACAATCCAAAGTCACTGTCAGAGAATGAAGTCTTGAAACTCTTCGA
GAAGATGATGGAAGATATGAATTTAAATGAAGATAAAAAGGCACCATTGCGGGAAAAAGACTTCAGTATCAAAAAAGAAATGGTGATGCAGTACATTAATACTGCTTCTAAGACAGGAAGTCTTAGAA
GTAGCCGACAGATCTCGCCTCAGGAATTCATCCATGAGCTGAAAATGGGTTACACAGGCGAGAGACTTTTCACATATCTGGAGTCACTCCGAGTATCATTGACCAGTAATCCAGTGAGTTGGGTGCAA
AACTTTGGACACGAGGGACTTGGATTATTACTGGACATTTTGGAAAAACTAATTAATGGGCAAATCCAAGAAAAAGTGGTGAAGAAGACTCAGCATAAAGTTATCCAGTGTCTGAGAGCCCTGATGAA
CACTCAGTATGGCTTAGAAAGAATTATGAGTGACGAGAGGAGTCTTTCCTTGTTGGCGAAAGCCATGGATCCCAAGCAACCCAGTATGATGGCAGATGTGGTGAAGCTTCTTTCTGCAGTGTGCATTG
TCGGGGAGGAGAGCATCCTTGAAGAAGTGTTAGAGGCCTTGACTTCAGCTGGAGAAGAAAGAAAAATTGACAGATTTTTTTCCATTGTGGAAGGCCTCCGGCATAATTCAGTGCAACTGCAGGTAGCT
TGTATGCAGCTCATAAATGCCCTTGTTACATCTCCTGATGATTTGGACTTCAGGCTTCACCTCAGAAATGAATTTATGCGTTGTGGATTGAAAGAGATATTGCCAAACTTAAAGGGTATTAAGAATGA
TGGCCTGGATATACAACTTAAAGTCTTTGATGAGCACAAAGAAGAAGATTTGAGTGAGTTCTCCCATCGCTTTGAAGATATCAGAGCTGAATTTGATGAAGCATCTGATGTTTACAGCGTGGTATGGG
ACACAGTTAAGGAAACTAGAGCAGAGGGACATTTTGTTTCTATTCTTCAGCATCTTCTGCTCATTCGAAATGATCGTTTTATAAGACAGCAGTACTTCAAGTTAATTGACGAGTGCGTGTCACAGATT
GTATTGCATAGAGATGGAATAGACCCCGACTTCACATACAGAAAAAGACTAGATTTGGACTTAAGTCAGTTTGTAGATGTTTGCATAGATCAGGCAAAACTAGAAGAGTGGGAAGAGAAAGCATCAGA
ACATTGCAAGAAATTTGAAAAAGAGTGTACTGACCACCAAGAAACCCAGGCTCAATTGCAGAAAAAAGAGGCAAAGATTAATGAGCTTCAAGCAGAGTTGCAAGCTTTTAAATCCCAGTTTGGTGCCT
TACCACCTGGTACAAAAATTCCTTTGCAAACTTCGGCAAAAGGTGAACCTGGCCCTTCAGCCTTTCCTCCTGCCCCACCAGCACTGGGTGCAGGAGTGCCGCCTCCCCCACCACCCCCACCTCCACCA
CCTCCACCTCTTCCGGGAATGGCAATGCCATTTGGTGGCCCAGTACCACCACCACCTCCCCTGGGATTTCTTGGTGGGCAAAACTTTATTCCATTAAACCTGCCATTTGGGTTGAAACCAAAGAAAGA
ATTTAAACCTGAAATCAGCATGAGAAGATTGAATTGGTTAAAGATCGGACCAAATGAAATGTCTGAGAACTGTTTCTGGATAAAAGTAAACGAAAATAAGTATGAAAATAAGGATTTGCTTTGTAAAC
TTGAGAACACATTTTGTTGCCTAGAAAAAGAGAAAAGGGATACAAATGATTTTGATGAGAAAAAAGTTATTAAGAAGAGAATGAAGGAACTTAAATTTCTAGATCCTAAAATTGCTCAGAACCTTTCA
ATCTTCTTGAGCTCCTTCCGGGTGCCTTATGAGAAAATCAGGACGATGATATTGGAAGTGGATGAAGCACAGTTGTCAGAGTCTATGATTCAGAACTTAATGAAGCACCTTCCAGATGAAGAGCAATT
GAAGTCATTGTCCCAGTTTAGAAGTGACTATAACAGTTTATGTGAGCCGGAGCAGTTTGCTGTCGTGATGAGCAATGTGAAGAGACTCCGGCCACGGCTCACTGCTATTCTCTTTAAGCTTCAATTTG
AAGAGCAGGTGAACAACATCAACCCTGACATCATGGCTGTCAGTACTGCCTGCGAGGAGATCAAGAAGAGCAAAAGCTTTAGCAAGTTGCTGGAACTTGTGTTGCTAATGGGAAACTACATGAATGCT
GGCTCCCGGAATGCTCAAACCTTCGGATTTGACCTTAGCTCTCTCTGTAAACTGAAGGACACAAAATCGGCAGACCAGAAAACAACCCTCCTCCATTTCCTGGTCGACGTATGTGAAGAAAAGCATCC
AGACATCCTTCCCTTCGTGGACGATTTGGCACATTTAGACAAAGCTAGTCGAGTCTCTGTAGAAATGCTGGAAAAGAGCTTGAAGCAGATGGGAAGGCAGCTTCTACAGCTTGAGAAGAATTTGGAAA
CCTTTCCCCCTCCTGAGGACTTGCATGACAAGTTTGTGATAAAGATGTCCAGCTTCATTATCACTGCGAAAGAGCACTATGGAAAACTCTCCACGCTACTGGACAACATGACACAACTGTACCAGAGC
GTGATGAGCTACTATGCTGTCGACACGAAGAAGGTTTCTGTGGAAGAGTTTTTTAATGACCTGAACAATTTCAGAACTTCATTTATGCAAGCATTAAAGGAAAACATCAGAAAAAGAGAAGCAGCAGA
AAAGGAGAAACGTGCTAGGATAGCAAAAGAGCGAGCAGAGAAGGAGCGACTGGAACGCCAGCAAGAGAAAAAGCGCTTGCTAGAAATGAAAACTGAGGGTGATGAGACAGGAGTGATGGATAGTCTGC
TAGAGGCCTTGCAGTCAGGGGCTGCCTTCCGCGACAGAAGAAAAAGGACACCAAAGCTGAAAGATATTCGGCAGAGTCTCAGTCCAATGTCTCAGAGGCCTGTTCTCAAAGTTTGTAACCATGAAAAT
CAGAAAATGCAGTTGAGTGAAGGGTCGCGTCCACACCACAGTATCAATTGCACCTCCACCAGGACTCCAGTCGCCAAGGAGCTTAATTGTAATCTAGACACTCATACATCTACAGGAAGGATCAAGGC
AGTTGAGAAGGAAGCCTGCAATGCAGAAAGCAACAGAAAAAAGGAAATGGAACTTCTTGGCTCTGTTTCTAAAAGCGAATCAGTTCCTGAGGTTGAAGCCCTGCTGGCGAGATTACGAGCTTTATAAA
TGAAACTGGTTAAAAAAATGATTAAGCCAAACCCCCAGCCACGCTTTCAGCTGGAACACTTGAAAAGTTGCTTGTATGTAAGTGACTTTATATAGATCTAAATTATGATATATACTAGAAGAAGTAAA
GCTAAATACGTGATCACAAGACTTTTCCTATATGCTTTTCCTCCTACATTACTCAAGATTGTAATGGGCTCTAATACTTTTATTTTTGTCTCCCGGTGTTCATTTATTCTGTATTTGCCAATTAAATT
ATACATGTTGCTTCAGAGAGCTAGGAAGCTGCCATGTGTTCAGCTGTGTCCTTAAGAAAATGAAATCTTTCTAAGTAATTTTTACCACTTCAACATTAATGAAAAGACATCAATCTGAAGACTTGGTG
TCTGTCCCTGTGTATATCATATTTGCTATCTGAATAGACCCAAATGTTTCCAATACAGCATCAGAAACATGTGTGTGTGTGTGTGTGTGTCCGTCTATCTGCATGAGCCATGATGTTGACTCACATTA
ACTAACACTGGAAGACGCACTTCCAAAAATGATGCAGTAAGAATGTTTGCACTTTCTTTGCAAAACACACAGGCGTTTTGCAAAGTAGGAATCTAAAGTAGGAATGTATATAGCATCTCAGTACTACC
TTGGTCTTAGCCAAGGAGACACTTTTACCCTCAGTATCATGGCTCTGAACTAAAATTACCATTCGGATTTTCCCACAGAATAATTTTTTATTTTTGACAAACTTAGGGTTTCAAATTTTTTAAAACTG
ACAATCAGTAACTGTGACAACAATCTGATATTTCGAGGACAGTTTCCATATGCAAAGGCTTCGATTGTACCTCACTTGGCACCATTCCTTTGTTATTTCCTTATCAAAAATAAATAAACTTGCTGCTT
GCACTGAAA

hide sequence

RefSeq Acc Id:

XM_063274159 ⟹ XP_063130229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,421,621 (-)	NCBI

RefSeq Acc Id:

XM_063274160 ⟹ XP_063130230

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,420,954 (-)	NCBI

RefSeq Acc Id:

XM_063274162 ⟹ XP_063130232

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,421,064 (-)	NCBI

RefSeq Acc Id:

XM_063274163 ⟹ XP_063130233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,421,623 (-)	NCBI

RefSeq Acc Id:

XM_063274164 ⟹ XP_063130234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	68,951,992 - 69,279,832 (-)	NCBI


Protein RefSeqs	NP_001292101	(Get FASTA)	NCBI Sequence Viewer
	XP_063130229	(Get FASTA)	NCBI Sequence Viewer
	XP_063130230	(Get FASTA)	NCBI Sequence Viewer
	XP_063130232	(Get FASTA)	NCBI Sequence Viewer
	XP_063130233	(Get FASTA)	NCBI Sequence Viewer
	XP_063130234	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02392	(Get FASTA)	NCBI Sequence Viewer
	EDM02393	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012167
	ENSRNOP00000082597
GenBank Protein	F1LVW7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001292101 ⟸ NM_001305172

- UniProtKB:

F1LVW7 (UniProtKB/Swiss-Prot), A0A0G2K8Y4 (UniProtKB/Swiss-Prot), A0A3B4PZE1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEKHRARALGRDSKASRRKGLPSAPPAGPYELGEKRPKLHLNIRTLTDDMLDKFASIRIPKGSKKERPPLPQLKTVSGSSDYSSVSSETMENNPKSLSENEVLKLFEKMMEDMNLNEDKKAPLREKDF
SIKKEMVMQYINTASKTGSLRSSRQISPQEFIHELKMGYTGERLFTYLESLRVSLTSNPVSWVQNFGHEGLGLLLDILEKLINGQIQEKVVKKTQHKVIQCLRALMNTQYGLERIMSDERSLSLLAKA
MDPKQPSMMADVVKLLSAVCIVGEESILEEVLEALTSAGEERKIDRFFSIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHLRNEFMRCGLKEILPNLKGIKNDGLDIQLKVFDEHKEEDLSEFS
HRFEDIRAEFDEASDVYSVVWDTVKETRAEGHFVSILQHLLLIRNDRFIRQQYFKLIDECVSQIVLHRDGIDPDFTYRKRLDLDLSQFVDVCIDQAKLEEWEEKASEHCKKFEKECTDHQETQAQLQK
KEAKINELQAELQAFKSQFGALPPGTKIPLQTSAKGEPGPSAFPPAPPALGAGVPPPPPPPPPPPPPLPGMAMPFGGPVPPPPPLGFLGGQNFIPLNLPFGLKPKKEFKPEISMRRLNWLKIGPNEMS
ENCFWIKVNENKYENKDLLCKLENTFCCLEKEKRDTNDFDEKKVIKKRMKELKFLDPKIAQNLSIFLSSFRVPYEKIRTMILEVDEAQLSESMIQNLMKHLPDEEQLKSLSQFRSDYNSLCEPEQFAV
VMSNVKRLRPRLTAILFKLQFEEQVNNINPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFDLSSLCKLKDTKSADQKTTLLHFLVDVCEEKHPDILPFVDDLAHLDKASRVSVE
MLEKSLKQMGRQLLQLEKNLETFPPPEDLHDKFVIKMSSFIITAKEHYGKLSTLLDNMTQLYQSVMSYYAVDTKKVSVEEFFNDLNNFRTSFMQALKENIRKREAAEKEKRARIAKERAEKERLERQQ
EKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRTPKLKDIRQSLSPMSQRPVLKVCNHENQKMQLSEGSRPHHSINCTSTRTPVAKELNCNLDTHTSTGRIKAVEKEACNAESNRKKEMELLGS
VSKSESVPEVEALLARLRAL

hide sequence

Ensembl Acc Id:

ENSRNOP00000012167 ⟸ ENSRNOT00000012167

Ensembl Acc Id:

ENSRNOP00000074783 ⟸ ENSRNOT00000087940

Ensembl Acc Id:

ENSRNOP00000082597 ⟸ ENSRNOT00000103316

RefSeq Acc Id:	XP_063130233 ⟸ XM_063274163
- Peptide Label:	isoform X3
- UniProtKB:	A0A3B4PZE1 (UniProtKB/TrEMBL)

Protein Domains

DAD FH1 FH2 GBD/FH3

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LVW7-F1-model_v2	AlphaFold	F1LVW7	1-1172	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699856

Promoter ID:

EPDNEW_R10378

Type:

multiple initiation site

Name:

Diaph3_1

Description:

diaphanous-related formin 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	70,400,004 - 70,400,064	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-12934	BioCyc
Ensembl Genes	ENSRNOG00000008986	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000012167	ENTREZGENE
	ENSRNOT00000103316	ENTREZGENE
Gene3D-CATH	1.10.20.40	UniProtKB/Swiss-Prot
	1.20.58.2220	UniProtKB/Swiss-Prot
	1.20.58.630	UniProtKB/Swiss-Prot
	1.25.10.10	UniProtKB/Swiss-Prot
	6.10.30.30	UniProtKB/Swiss-Prot
	Formin, FH3 diaphanous domain	UniProtKB/Swiss-Prot
InterPro	ARM-like	UniProtKB/Swiss-Prot
	ARM-type_fold	UniProtKB/Swiss-Prot
	DAD_dom	UniProtKB/Swiss-Prot
	DIA_GBD_sf	UniProtKB/Swiss-Prot
	FH2_Formin	UniProtKB/Swiss-Prot
	FH2_Formin_sf	UniProtKB/Swiss-Prot
	FH3_dom	UniProtKB/Swiss-Prot
	Formin_Homology_Diaphanous_sf	UniProtKB/Swiss-Prot
	GBD/FH3_dom	UniProtKB/Swiss-Prot
	GTPase-bd	UniProtKB/Swiss-Prot
KEGG Report	rno:290396	UniProtKB/Swiss-Prot
NCBI Gene	290396	ENTREZGENE
PANTHER	PROTEIN DIAPHANOUS	UniProtKB/Swiss-Prot
	PTHR45691:SF9	UniProtKB/Swiss-Prot
Pfam	Drf_FH3	UniProtKB/Swiss-Prot
	Drf_GBD	UniProtKB/Swiss-Prot
	FH2	UniProtKB/Swiss-Prot
PhenoGen	Diaph3	PhenoGen
PROSITE	DAD	UniProtKB/Swiss-Prot
	FH2	UniProtKB/Swiss-Prot
	GBD_FH3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008986	RatGTEx
SMART	Drf_FH3	UniProtKB/Swiss-Prot
	Drf_GBD	UniProtKB/Swiss-Prot
	FH2	UniProtKB/Swiss-Prot
Superfamily-SCOP	Formin homology 2 domain (FH2 domain)	UniProtKB/Swiss-Prot
	SSF48371	UniProtKB/Swiss-Prot
UniProt	A0A0G2K8Y4	ENTREZGENE
	A0A3B4PZE1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZXD1_RAT	UniProtKB/TrEMBL
	DIAP3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A0A0G2K8Y4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-26	Diaph3	diaphanous homolog 3 (Drosophila)	Diap3	diaphanous homolog 3 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Diap3	diaphanous homolog 3 (Drosophila)	LOC290396	similar to Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (mDIA2) (p134mDIA2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC290396	similar to Protein diaphanous homolog 3 (Diaphanous-related formin-3) (DRF3) (mDIA2) (p134mDIA2)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM