Plpp5 (phospholipid phosphatase 5)

Gene: Plpp5 (phospholipid phosphatase 5) Rattus norvegicus

Analyze

Symbol:

Plpp5

Name:

phospholipid phosphatase 5

RGD ID:

1591734

Description:

Predicted to enable diacylglycerol diphosphate phosphatase activity and phosphatidate phosphatase activity. Predicted to be involved in phospholipid dephosphorylation and phospholipid metabolic process. Predicted to be active in membrane. Orthologous to human PLPP5 (phospholipid phosphatase 5); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC680466; phosphatidate phosphatase PPAPDC1B; phosphatidic acid phosphatase type 2 domain containing 1B; Ppapdc1b; similar to phosphatidic acid phosphatase type 2 domain containing 1A

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLPP5 (phospholipid phosphatase 5)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Plpp5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Plpp5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLPP5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLPP5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Plpp5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLPP5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLPP5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Plpp5 (phospholipid phosphatase 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Plpp5 (phospholipid phosphatase 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PLPP5 (phospholipid phosphatase 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	plpp5 (phospholipid phosphatase 5)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG12746	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DPP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	plpp5	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	73,052,204 - 73,056,609 (-)	NCBI		GRCr8
mRatBN7.2	16	66,349,483 - 66,353,887 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	66,349,502 - 66,464,797 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	71,628,226 - 71,632,366 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	75,034,533 - 75,038,673 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	70,274,391 - 70,278,527 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	71,121,175 - 71,125,794 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	71,121,175 - 71,125,316 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	70,782,080 - 70,786,221 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	70,724,412 - 70,728,550 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	16	64,259,194 - 64,263,315 (-)	NCBI		Celera
Cytogenetic Map	16	q12.4	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hereditary spastic paraplegia 54 (ISO)

hypogonadotropic hypogonadism 2 with or without anosmia (ISO)

paraplegia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

belinostat (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diuron (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

genistein (ISO)

glafenine (EXP)

indometacin (EXP)

methapyrilene (EXP)

methidathion (ISO)

nimesulide (EXP)

paracetamol (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

trichostatin A (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

phospholipid dephosphorylation (IBA,ISO)

phospholipid metabolic process (IBA,IEA)

Cellular Component

membrane (IBA)

Molecular Function

diacylglycerol diphosphate phosphatase activity (ISO)

phosphatidate phosphatase activity (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17590538

Genomics

Comparative Map Data

Plpp5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	73,052,204 - 73,056,609 (-)	NCBI		GRCr8
mRatBN7.2	16	66,349,483 - 66,353,887 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	66,349,502 - 66,464,797 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	71,628,226 - 71,632,366 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	75,034,533 - 75,038,673 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	70,274,391 - 70,278,527 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	71,121,175 - 71,125,794 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	71,121,175 - 71,125,316 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	70,782,080 - 70,786,221 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	70,724,412 - 70,728,550 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	16	64,259,194 - 64,263,315 (-)	NCBI		Celera
Cytogenetic Map	16	q12.4	NCBI

PLPP5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	38,263,130 - 38,269,224 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	38,263,130 - 38,269,243 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	38,120,648 - 38,126,742 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	38,239,805 - 38,245,895 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	8	37,073,700 - 37,079,790 (-)	NCBI		Celera
Cytogenetic Map	8	p11.23	NCBI
HuRef	8	36,654,710 - 36,660,800 (-)	NCBI		HuRef
CHM1_1	8	38,322,649 - 38,328,743 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	38,540,085 - 38,546,179 (-)	NCBI		T2T-CHM13v2.0

Plpp5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	26,210,052 - 26,214,914 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	26,210,064 - 26,214,914 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	25,720,043 - 25,724,887 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	25,720,037 - 25,724,887 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	26,830,520 - 26,835,359 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	27,185,582 - 27,192,853 (+)	NCBI		MGSCv36	mm8
Celera	8	27,188,334 - 27,193,173 (+)	NCBI		Celera
Cytogenetic Map	8	A2	NCBI
cM Map	8	14.17	NCBI

Plpp5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955463	13,859,502 - 13,864,090 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955463	13,859,492 - 13,864,104 (-)	NCBI	ChiLan1.0	ChiLan1.0

PLPP5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	56,826,600 - 56,832,756 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	32,542,690 - 32,550,123 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	37,565,227 - 37,571,698 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	34,741,834 - 34,748,078 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	34,741,842 - 34,748,012 (-)	Ensembl	panpan1.1		panPan2

PLPP5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	27,226,110 - 27,232,743 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	27,226,188 - 27,231,157 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	27,743,440 - 27,749,426 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	29,124,686 - 29,131,173 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	29,124,203 - 29,130,445 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	27,347,536 - 27,353,516 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	27,924,869 - 27,930,850 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	27,964,106 - 27,970,087 (+)	NCBI		UU_Cfam_GSD_1.0

Plpp5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	49,836,008 - 49,841,990 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936710	1,620,012 - 1,624,737 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936710	1,619,975 - 1,625,426 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLPP5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	48,246,029 - 48,252,196 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	48,246,054 - 48,251,839 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	55,408,344 - 55,414,428 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLPP5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	36,278,881 - 36,288,540 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	36,280,243 - 36,284,639 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666052	5,701,331 - 5,711,893 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plpp5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624780	5,368,824 - 5,373,240 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624780	5,368,543 - 5,374,248 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Plpp5
9 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	84
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000020900
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70215	Niddm29	Non-insulin dependent diabetes mellitus QTL 29	3.54		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	16	19004435	75226532	Rat
2302057	Pia29	Pristane induced arthritis QTL 29	3.6	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	16	21735975	66735975	Rat
8694453	Bw172	Body weight QTL 172	8.33	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	16	24325513	69325513	Rat
6903294	Stl30	Serum triglyceride level QTL 30	2.6	0.0013	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	16	25152793	70152793	Rat
1578768	Stresp22	Stress response QTL 22	2.8		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	16	35288870	80288870	Rat
2293690	Bss45	Bone structure and strength QTL 45	5.13	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	16	37752156	82752156	Rat
2300163	Bmd64	Bone mineral density QTL 64	5.3	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	16	37752156	82752156	Rat
7205510	Activ5	Activity QTL 5	3.78	0.00028	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	42396345	84729064	Rat
8694429	Bw164	Body weight QTL 164	5	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	16	52726464	84729064	Rat
8694364	Abfw7	Abdominal fat weight QTL 7	12.22	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	16	52726464	84729064	Rat
7411648	Foco22	Food consumption QTL 22	15	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	52726464	84729064	Rat
631525	Pia14	Pristane induced arthritis QTL 14	4.4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	16	55711087	83402471	Rat

Markers in Region

BE109486

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,355,302 - 66,355,454 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	71,126,998 - 71,127,149	NCBI	Rnor6.0
Rnor_5.0	16	70,787,903 - 70,788,054	UniSTS	Rnor5.0
RGSC_v3.4	16	70,730,232 - 70,730,383	UniSTS	RGSC3.4
Celera	16	64,264,997 - 64,265,148	UniSTS
RH 3.4 Map	16	633.0	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

RH143819

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,354,715 - 66,354,841 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	71,126,411 - 71,126,536	NCBI	Rnor6.0
Rnor_5.0	16	70,787,316 - 70,787,441	UniSTS	Rnor5.0
RGSC_v3.4	16	70,729,645 - 70,729,770	UniSTS	RGSC3.4
Celera	16	64,264,410 - 64,264,535	UniSTS
RH 3.4 Map	16	625.4	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

RH137356

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	66,349,755 - 66,349,965 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	71,121,448 - 71,121,657	NCBI	Rnor6.0
Rnor_5.0	16	70,782,353 - 70,782,562	UniSTS	Rnor5.0
RGSC_v3.4	16	70,724,685 - 70,724,894	UniSTS	RGSC3.4
Celera	16	64,259,467 - 64,259,676	UniSTS
RH 3.4 Map	16	625.4	UniSTS
Cytogenetic Map	16	q12.4	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	28	57	41	19	41			67	35	34	11
Low		15					8	11	7		7		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109411	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008771367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020900 ⟹ ENSRNOP00000020900

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	16	71,121,175 - 71,125,316 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113020 ⟹ ENSRNOP00000096085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	66,349,502 - 66,464,797 (-)	Ensembl

RefSeq Acc Id:

NM_001109411 ⟹ NP_001102881

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	73,052,204 - 73,056,342 (-)	NCBI
mRatBN7.2	16	66,349,483 - 66,353,621 (-)	NCBI
Rnor_6.0	16	71,121,175 - 71,125,316 (-)	NCBI
Rnor_5.0	16	70,782,080 - 70,786,221 (-)	NCBI
RGSC_v3.4	16	70,724,412 - 70,728,550 (-)	RGD
Celera	16	64,259,194 - 64,263,315 (-)	RGD

Sequence:

show sequence

CCACGTCAGCGTCTGATCTGCCGGCCGCGCGTGTGGCGAGATGGGGAATGCGGCCCTGGGAGCG
GAGCTGGGCGTGCGGGTCCTGCTCTTTGTGGCCTTCCTGGCGACCGAGCTGCTCCCTCCCTTCC
AGCGGCGGATTCAGCCCGAGGAGCTGTGGCTTTACCGGAACCCGTACGTGGAGGCGGAATACTT
CCCCACCGGCCCCATGTTTGTCATTGCCTTTCTCACCCCACTGTCCCTGATCTTCTTCGCCAAG
TTTCTGAGGAAAGCTGACGCCACCGACAGCAAGCAAGCCTGCCTCGCTGCCAGCCTTGCCCTAG
CTCTGAATGGTGTCTTTACCAACATCATAAAACTGATAGTGGGCAGGCCACGCCCAGATTTCTT
CTACCGATGCTTCCCCGACGGGATGGCCCATTCTGACCTGACTTGCACAGGGGACAAGGATGTG
GTGAATGAGGGCCGAAAGAGCTTCCCCAGTGGACACTCTTCCTTTGCCTTTGCTGGCCTGGCCT
TTGCTTCCTTCTACCTGGCAGGGAAGTTACACTGCTTCACACCCCAAGGCCGAGGGAAGTCCTG
GAGGCTCTGTGCCTTTCTGTCACCTTTACTCTTTGCAGCTGTGATTGCACTGTCCCGCACGTGT
GACTATAAGCACCACTGGCAAGATGTGCTCGTTGGATCCATGATTGGAACAACATTTGCCTATG
TCTGCTACAGGCAGTACTACCCCCCTCTCACTGACACAGAGTGCCATAAACCATTCCAGGACAA
GCACAGACTTCCGTCTTCACAGAAGCCCAGTGTGCCTCACCGTTTGGACATTTAGTTGAGTCTA
CCTCAGTGGAGAGCAAGCAAATCAATCCTCCTAACTGGACACCATGCACAAGCCAAGGATTTCT
GGCTTTTACCTCTTCCAAGGTCAAAGGGAGGACACAGCCACACTGTGCACCTTTGCCCCACTTC
CAAGGCTAGACCCTGAGGTCTCACTGCCTGGCTTGACACGGGCTCTCTCAGTGCTTCTCTCACT
AGGTTAATGAGTCCGGTCCCAGTATTCTCAGATCTAGTCAGTGTCTTTATGTCGATGTAAATGT
CACTCCTGAAGAAAGCTTTTTATAAAGGAAGCTTCTCATGACCCCATTTTATCCTAGAAGGCTT
AATTACCAGACATAATCTCTGTCCCTTATAAATTAGGGCAGTTCCAAACTTTGATTCTGTTTAC
TTTTTGTGGTAACATTCCATTAAGCCTTAAATAATAAAACATCCAATTTTTTACTTTTTACTAC
ATTAGGAAAGAAAACTTATGGGTGTTATCTAGAAGATAAATGTATCTTTTTCTGCCTTTTGTTC
ACAAAGAAACATATGGAGCAGCTAAAGGCTCTCACTAGAACTTGATCCTGAGGACCACTTGATG
GATAGCTACCTTTTCTTCATTGTTACTATACTTTAAATAAAATTCAGTCTTGTGTATTTCTTCC
TATAACATAC

hide sequence

RefSeq Acc Id:

XM_063275717 ⟹ XP_063131787

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	73,052,222 - 73,056,609 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102881	(Get FASTA)	NCBI Sequence Viewer
	XP_063131787	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM09063	(Get FASTA)	NCBI Sequence Viewer
	EDM09064	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000096085
	ENSRNOP00000096085.1

RefSeq Acc Id:

NP_001102881 ⟸ NM_001109411

- UniProtKB:

A6IW07 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGNAALGAELGVRVLLFVAFLATELLPPFQRRIQPEELWLYRNPYVEAEYFPTGPMFVIAFLTP
LSLIFFAKFLRKADATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFPDGMAHSDL
TCTGDKDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWRLCAFLSPLLFAA
VIALSRTCDYKHHWQDVLVGSMIGTTFAYVCYRQYYPPLTDTECHKPFQDKHRLPSSQKPSVPH
RLDI

hide sequence

RefSeq Acc Id:

ENSRNOP00000020900 ⟸ ENSRNOT00000020900

RefSeq Acc Id:

ENSRNOP00000096085 ⟸ ENSRNOT00000113020

RefSeq Acc Id:	XP_063131787 ⟸ XM_063275717
- Peptide Label:	isoform X1

Protein Domains

Phosphatidic acid phosphatase type 2/haloperoxidase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZIJ1-F1-model_v2	AlphaFold	D3ZIJ1	1-260	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700169

Promoter ID:

EPDNEW_R10693

Type:

initiation region

Name:

Plpp5_1

Description:

phospholipid phosphatase 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	71,125,295 - 71,125,355	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591734	AgrOrtholog
BioCyc Gene	G2FUF-10970	BioCyc
Ensembl Genes	ENSRNOG00000015568	Ensembl
	ENSRNOG00000069017	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000113020	ENTREZGENE
	ENSRNOT00000113020.1	UniProtKB/TrEMBL
Gene3D-CATH	Phosphatidic acid phosphatase type 2/haloperoxidase	UniProtKB/TrEMBL
InterPro	P_Acid_Pase_2/haloperoxi_sf	UniProtKB/TrEMBL
	P_Acid_Pase_2/haloperoxidase	UniProtKB/TrEMBL
	PA_PP_rel	UniProtKB/TrEMBL
KEGG Report	rno:680466	UniProtKB/TrEMBL
NCBI Gene	680466	ENTREZGENE
PANTHER	PTHR10165	UniProtKB/TrEMBL
	PTHR10165:SF87	UniProtKB/TrEMBL
Pfam	PAP2	UniProtKB/TrEMBL
PhenoGen	Plpp5	PhenoGen
RatGTEx	ENSRNOG00000015568	RatGTEx
	ENSRNOG00000069017	RatGTEx
SMART	acidPPc	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48317	UniProtKB/TrEMBL
UniProt	A0A8I6B3Q2_RAT	UniProtKB/TrEMBL
	A6IW07	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-26	Plpp5	phospholipid phosphatase 5	Ppapdc1b	phosphatidic acid phosphatase type 2 domain containing 1B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Ppapdc1b	phosphatidic acid phosphatase type 2 domain containing 1B	LOC680466	similar to phosphatidic acid phosphatase type 2 domain containing 1A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC680466	similar to phosphatidic acid phosphatase type 2 domain containing 1A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar