Advanced Search (OLGA)

Gene: Sem1 (SEM1 26S proteasome subunit) Rattus norvegicus

Analyze

Symbol:

Sem1

Name:

SEM1 26S proteasome subunit

RGD ID:

1590628

Description:

Predicted to be involved in double-strand break repair via homologous recombination. Predicted to be located in nucleus. Predicted to be part of integrator complex and proteasome complex. Orthologous to human SEM1 (SEM1 26S proteasome subunit); PARTICIPATES IN homologous recombination pathway of double-strand break repair; ubiquitin/proteasome degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

26S proteasome complex subunit DSS1; 26S proteasome complex subunit SEM1; Dss1; LOC680532; SEM1, 26S proteasome complex subunit; Shfm1; similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog); split hand/foot malformation (ectrodactyly) type 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SEM1 (SEM1 26S proteasome subunit)	HGNC	HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sem1 (SEM1, 26S proteasome complex subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sem1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SEM1 (SEM1, 26S proteasome complex subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SEM1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sem1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SEM1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SEM1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sem1 (SEM1 26S proteasome subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SEM1 (SEM1 26S proteasome subunit)	Alliance	DIOPT (HGNC)
Homo sapiens (human):	SEM1 (SEM1 26S proteasome subunit)	Alliance	DIOPT (HGNC\|PANTHER)
Mus musculus (house mouse):	Sem1 (SEM1, 26S proteasome complex subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dss-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dss-1	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sem1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sem1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sem1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEM1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEM1	Alliance	DIOPT (OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sem1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	sem1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	35,638,306 - 35,658,462 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	35,638,306 - 35,658,462 (-)	Ensembl				GRCr8
mRatBN7.2	4	34,671,848 - 34,692,005 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	34,671,848 - 34,692,005 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	39,630,761 - 39,650,917 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	35,556,939 - 35,577,095 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	33,967,809 - 33,986,207 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	32,067,444 - 32,087,600 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	32,067,444 - 32,087,600 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	31,935,396 - 31,955,552 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	31,316,084 - 31,336,240 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	30,194,687 - 30,214,799 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

squamous cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

antimycin A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bicalutamide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

chloropicrin (ISO)

choline (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

disulfiram (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

glyphosate (EXP)

indometacin (ISO)

isobutanol (ISO)

L-methionine (ISO)

mechlorethamine (ISO)

methimazole (EXP)

nitrates (ISO)

paracetamol (ISO)

phenobarbital (ISO)

PhIP (EXP)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

propiconazole (EXP)

resveratrol (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

thiram (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

double-strand break repair via homologous recombination (IBA,ISO)

mRNA export from nucleus (IEA)

proteasomal protein catabolic process (NAS)

proteasome assembly (IEA)

Cellular Component

integrator complex (IEA,ISO)

nucleus (IEA)

proteasome complex (IBA,IEA,ISO)

proteasome regulatory particle, lid subcomplex (IEA)

protein-containing complex (IEA,ISO)

synaptic vesicle (NAS)

Molecular Function

protein binding (ISO)

ubiquitin binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

homologous recombination pathway of double-strand break repair (IEA)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	An abundance of free regulatory (19S) proteasome particles regulates neuronal synapses.	Sun C, etal., Science. 2023 May 26;380(6647):eadf2018. doi: 10.1126/science.adf2018. Epub 2023 May 26.

Additional References at PubMed

PMID:12228710	PMID:15117943	PMID:15359272	PMID:16239144	PMID:17323924	PMID:17975104

Genomics

Comparative Map Data

Sem1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	35,638,306 - 35,658,462 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	35,638,306 - 35,658,462 (-)	Ensembl				GRCr8
mRatBN7.2	4	34,671,848 - 34,692,005 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	34,671,848 - 34,692,005 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	39,630,761 - 39,650,917 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	35,556,939 - 35,577,095 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	33,967,809 - 33,986,207 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	32,067,444 - 32,087,600 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	32,067,444 - 32,087,600 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	31,935,396 - 31,955,552 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	31,316,084 - 31,336,240 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	30,194,687 - 30,214,799 (-)	NCBI		Celera
Cytogenetic Map	4	q21	NCBI

SEM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	96,481,626 - 96,709,846 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	96,481,626 - 96,709,891 (-)	Ensembl			hg38	GRCh38
GRCh37	7	96,110,938 - 96,339,158 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	96,156,015 - 96,177,139 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	95,962,730 - 95,983,854	NCBI
Celera	7	91,018,094 - 91,039,215 (-)	NCBI		Celera
Cytogenetic Map	7	q21.3	NCBI
HuRef	7	90,925,925 - 90,947,056 (-)	NCBI		HuRef
CHM1_1	7	96,248,097 - 96,269,218 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	97,717,281 - 97,945,489 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	95,646,961 - 95,668,081 (-)	NCBI

Sem1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	6,558,275 - 6,578,658 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	6,557,294 - 6,578,663 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	6,558,275 - 6,578,658 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	6,557,294 - 6,578,663 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	6,508,275 - 6,528,658 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	6,508,288 - 6,528,592 (-)	NCBI		MGSCv36	mm8
Celera	6	6,710,797 - 6,731,239 (-)	NCBI		Celera
Cytogenetic Map	6	A1	NCBI
cM Map	6	2.59	NCBI

Sem1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955432	13,134,359 - 13,156,397 (-)	Ensembl
ChiLan1.0	NW_004955432	13,134,359 - 13,156,402 (-)	NCBI	ChiLan1.0	ChiLan1.0

SEM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	114,464,761 - 114,553,287 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	162,722,956 - 162,817,908 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	88,647,366 - 88,668,476 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	102,216,150 - 102,253,046 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

SEM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	21,767,105 - 21,790,229 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	21,327,804 - 21,350,913 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	21,589,103 - 21,612,213 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	21,549,709 - 21,612,216 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	21,734,731 - 21,757,840 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	21,470,387 - 21,493,501 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	21,729,292 - 21,752,408 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sem1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	35,115,413 - 35,136,091 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936585	3,727,126 - 3,750,473 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936585	3,727,199 - 3,747,873 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SEM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	9	76,324,550 - 76,349,261 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	83,962,666 - 83,987,375 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SEM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	52,342,382 - 52,364,110 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	52,342,397 - 52,364,103 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666042	51,986,099 - 52,022,116 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sem1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	46,159,208 - 46,159,645 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sem1
160 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	373
Count of miRNA genes:	192
Interacting mature miRNAs:	220
Transcripts:	ENSRNOT00000013841
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	13080146	58080146	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	15644309	60644309	Rat
5685012	Bmd87	Bone mineral density QTL 87	5.1		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	4	35113290	80113290	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	11038706	56038706	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
8655949	Rf62	Renal function QTL 62	22		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	4	35396600	45429897	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	11038706	56038706	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	22288453	40471598	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5894575	57613242	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	11038706	56038706	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	11706604	92690519	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	18900697	63900697	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	1	45429897	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	11038706	56038706	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	22288453	63245191	Rat
8552807	Vie4	Viral induced encephalitis QTL 4	7.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	18900697	63900697	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	11038706	56038706	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	30448961	82336920	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	40471598	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5889999	50889999	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	18913151	63913151	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	27862204	62997402	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21925151	66925151	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	1	63900697	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	11038706	56038706	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	33538816	53719714	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	22288453	45429897	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10758701	40490708	Rat

Markers in Region

BF409430

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	34,675,649 - 34,675,803 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	32,071,246 - 32,071,399	NCBI	Rnor6.0
Rnor_5.0	4	31,939,198 - 31,939,351	UniSTS	Rnor5.0
RGSC_v3.4	4	31,319,886 - 31,320,039	UniSTS	RGSC3.4
Celera	4	30,198,489 - 30,198,642	UniSTS
RH 3.4 Map	4	811.53	UniSTS
Cytogenetic Map	4	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001126090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131886	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013841 ⟹ ENSRNOP00000013841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	35,638,306 - 35,658,462 (-)	Ensembl
mRatBN7.2 Ensembl	4	34,671,848 - 34,692,005 (-)	Ensembl
Rnor_6.0 Ensembl	4	32,067,444 - 32,087,600 (-)	Ensembl

RefSeq Acc Id:

NM_001126090 ⟹ NP_001119562

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	35,638,306 - 35,658,462 (-)	NCBI
mRatBN7.2	4	34,671,848 - 34,692,005 (-)	NCBI
Rnor_6.0	4	32,067,444 - 32,087,600 (-)	NCBI
Rnor_5.0	4	31,935,396 - 31,955,552 (-)	NCBI
RGSC_v3.4	4	31,316,084 - 31,336,240 (-)	RGD
Celera	4	30,194,687 - 30,214,799 (-)	RGD

Sequence:

show sequence

GCCCTGTAGCTCTTCCCCTCTAGTCTCTATGGTTGCGCCGGCGTTGGTAGTATCGGCGCCTCAC
TAGTACTGAGGCTTCCAACTTTGTGGTCGATCTCTGAGCGTTGTTGGGGCTTGGCGCTGCGCTA
TGTCCGAGAAGAAGCAGCCTGTCGACTTGGGTCTCCTGGAAGAGGACGACGAGTTCGAGGAGTT
TCCCGCGGAAGACTGGGCCGGCTTAGATGAAGATGAAGATGCACATGTCTGGGAGGATAATTGG
GATGATGACAATGTAGAAGACGACTTCTCCAATCAGTTACGCGCTGAGCTGGAGAAGCATGGTT
ACAAGATGGAGACTTCATAGCATCCAGGAATGTTCCAGGAACTTAAACATGGACTCTACCACAT
TCTCGGACAGAGAAACCAGCATGGGATACTTTAGAGAATATGTTTATTTCATTATCTCTGGGAT
TTATTTTTGTTTGTATAAGAAAAACATAAGTAAATAAATGTTTTGATCTAATCTTTTTGGTTCA
GATGTCTTGATCTTTTGCCTCTATCCCTAAATTTTATACTCATGAGTTTTAAGAAACTTATTAA
TATTATCCCAGTAAAGTTCACATTATAAAATTTTTTAATACTAATCAAACAGTCAGATGTTGGG
CTTTATCAGATTATCCAATTTTACAAGATGTTTCTATTGTATGACATTAAATTTTAATACCTTC
TGTCTTTTACTATAAGCAACATTTTCTGAAGTTTGAAGGAGACCCTTTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001119562	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15031	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013841
	ENSRNOP00000013841.2

RefSeq Acc Id:	NP_001119562 ⟸ NM_001126090
- UniProtKB:	D3ZHW9 (UniProtKB/TrEMBL), A6IDU4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHG YKMETS hide sequence

Ensembl Acc Id:

ENSRNOP00000013841 ⟸ ENSRNOT00000013841

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZHW9-F1-model_v2	AlphaFold	D3ZHW9	1-70	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692866

Promoter ID:

EPDNEW_R3390

Type:

initiation region

Name:

Sem1_1

Description:

SEM1, 26S proteasome complex subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	32,087,579 - 32,087,639	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590628	AgrOrtholog
BioCyc Gene	G2FUF-45687	BioCyc
Ensembl Genes	ENSRNOG00000010420	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013841	ENTREZGENE
	ENSRNOT00000013841.5	UniProtKB/TrEMBL
InterPro	DSS1_SEM1	UniProtKB/TrEMBL
KEGG Report	rno:680532	UniProtKB/TrEMBL
NCBI Gene	680532	ENTREZGENE
PANTHER	26S PROTEASOME COMPLEX SUBUNIT SEM1	UniProtKB/TrEMBL
	PTHR16771	UniProtKB/TrEMBL
Pfam	DSS1_SEM1	UniProtKB/TrEMBL
PhenoGen	Sem1	PhenoGen
RatGTEx	ENSRNOG00000010420	RatGTEx
SMART	DSS1_SEM1	UniProtKB/TrEMBL
UniProt	A6IDU4	ENTREZGENE, UniProtKB/TrEMBL
	D3ZHW9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Sem1	SEM1 26S proteasome subunit	Sem1	SEM1, 26S proteasome complex subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-12-05	Sem1	SEM1, 26S proteasome complex subunit	Shfm1	split hand/foot malformation (ectrodactyly) type 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Shfm1	split hand/foot malformation (ectrodactyly) type 1	LOC680532	similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC680532	similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog)	LOC679014	similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog)	Data merged from RGD:1593110	1643240	APPROVED
2006-11-20	LOC680532	similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC679014	similar to 26 proteasome complex subunit DSS1 (Deleted in split hand/split foot protein 1) (Split hand/foot deleted protein 1 homolog)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)