Symbol:
Apcdd1
Name:
APC down-regulated 1
RGD ID:
1589962
Description:
Predicted to enable Wnt-protein binding activity and identical protein binding activity. Predicted to be involved in hair follicle development; negative regulation of Wnt signaling pathway; and regulation of odontogenesis of dentin-containing tooth. Predicted to act upstream of or within astrocyte cell migration. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in hypotrichosis 1. Orthologous to human APCDD1 (APC down-regulated 1); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
adenomatosis polyposis coli down-regulated 1; LOC689616; similar to adenomatosis polyposis coli down-regulated 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 58,655,696 - 58,686,359 (+) NCBI GRCr8 mRatBN7.2 18 56,385,398 - 56,416,065 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 56,385,264 - 56,416,070 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 18 58,270,398 - 58,300,982 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 58,270,410 - 58,301,002 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 57,494,395 - 57,523,899 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 59,088,709 - 59,091,205 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 54,532,957 - 54,563,430 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Apcdd1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of APCDD1 mRNA] CTD PMID:31150632 Apcdd1 Rat 1,2-dimethylhydrazine increases expression ISO Apcdd1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of APCDD1 mRNA CTD PMID:22206623 Apcdd1 Rat 1-nitropyrene decreases expression ISO APCDD1 (Homo sapiens) 6480464 1-nitropyrene results in decreased expression of APCDD1 mRNA CTD PMID:19041380 Apcdd1 Rat 17beta-estradiol decreases expression ISO Apcdd1 (Mus musculus) 6480464 Estradiol results in decreased expression of APCDD1 mRNA CTD PMID:14664709 Apcdd1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of APCDD1 mRNA CTD PMID:32145629 Apcdd1 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with EGF protein] results in decreased expression of APCDD1 mRNA CTD PMID:16054899 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO APCDD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of APCDD1 mRNA CTD PMID:36370075 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of APCDD1 mRNA CTD PMID:34747641 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of APCDD1 mRNA CTD PMID:32109520 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO APCDD1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of APCDD1 mRNA CTD PMID:22298810 Apcdd1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Apcdd1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of APCDD1 mRNA CTD PMID:16054899 and PMID:19933214 Apcdd1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Apcdd1 Rat 2,4-diaminotoluene increases expression ISO Apcdd1 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of APCDD1 mRNA CTD PMID:20713471 Apcdd1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of APCDD1 mRNA more ... CTD PMID:16054899 and PMID:28242765 Apcdd1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of APCDD1 mRNA more ... CTD PMID:28242765 and PMID:28628672 Apcdd1 Rat 3-methylcholanthrene increases expression ISO Apcdd1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of APCDD1 mRNA CTD PMID:20713471 Apcdd1 Rat 4,4'-sulfonyldiphenol increases expression ISO APCDD1 (Homo sapiens) 6480464 bisphenol S results in increased expression of APCDD1 mRNA CTD PMID:27685785 Apcdd1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of APCDD1 mRNA CTD PMID:28628672 Apcdd1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Apcdd1 (Mus musculus) 6480464 Fenretinide results in decreased expression of APCDD1 mRNA CTD PMID:28973697 Apcdd1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of APCDD1 mRNA CTD PMID:24780913 Apcdd1 Rat 8-Br-cAMP decreases expression ISO APCDD1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of APCDD1 mRNA CTD PMID:22079614 Apcdd1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of APCDD1 mRNA CTD PMID:28959563 Apcdd1 Rat acrylamide decreases expression ISO APCDD1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of APCDD1 mRNA CTD PMID:32763439 Apcdd1 Rat aflatoxin B1 increases methylation ISO APCDD1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of APCDD1 intron CTD PMID:30157460 Apcdd1 Rat Aflatoxin B2 alpha decreases methylation ISO APCDD1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of APCDD1 intron CTD PMID:30157460 Apcdd1 Rat all-trans-retinoic acid decreases expression ISO APCDD1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of APCDD1 mRNA CTD PMID:33167477 Apcdd1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of APCDD1 mRNA CTD PMID:35163327 Apcdd1 Rat arsane multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of APCDD1 mRNA CTD PMID:32525701 Apcdd1 Rat arsenic atom multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of APCDD1 mRNA CTD PMID:32525701 Apcdd1 Rat benzo[a]pyrene affects methylation ISO APCDD1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of APCDD1 promoter CTD PMID:27901495 Apcdd1 Rat benzo[a]pyrene increases methylation ISO APCDD1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of APCDD1 3' UTR CTD PMID:27901495 Apcdd1 Rat benzo[a]pyrene diol epoxide I affects expression ISO APCDD1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Apcdd1 Rat benzo[b]fluoranthene increases expression ISO Apcdd1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of APCDD1 mRNA CTD PMID:26377693 Apcdd1 Rat beta-lapachone decreases expression ISO APCDD1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of APCDD1 mRNA CTD PMID:38218311 Apcdd1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Apcdd1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of APCDD1 mRNA CTD PMID:34319233 Apcdd1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of APCDD1 mRNA CTD PMID:25181051 Apcdd1 Rat bisphenol A decreases methylation ISO APCDD1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of APCDD1 gene CTD PMID:31601247 Apcdd1 Rat bisphenol A increases expression ISO Apcdd1 (Mus musculus) 6480464 bisphenol A results in increased expression of APCDD1 mRNA CTD PMID:35479511 and PMID:38701888 Apcdd1 Rat bisphenol A decreases expression ISO APCDD1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of APCDD1 mRNA CTD PMID:33670352 Apcdd1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of APCDD1 mRNA CTD PMID:32145629 Apcdd1 Rat bisphenol A multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of APCDD1 mRNA CTD PMID:28628672 Apcdd1 Rat calcitriol decreases expression ISO APCDD1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of APCDD1 mRNA CTD PMID:16002434 Apcdd1 Rat carbamazepine affects expression ISO APCDD1 (Homo sapiens) 6480464 Carbamazepine affects the expression of APCDD1 mRNA CTD PMID:25979313 Apcdd1 Rat choline multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of APCDD1 mRNA CTD PMID:20938992 Apcdd1 Rat clobetasol decreases expression ISO Apcdd1 (Mus musculus) 6480464 Clobetasol results in decreased expression of APCDD1 mRNA CTD PMID:27462272 Apcdd1 Rat copper(II) sulfate affects expression ISO APCDD1 (Homo sapiens) 6480464 Copper Sulfate affects the expression of APCDD1 mRNA CTD PMID:19549813 Apcdd1 Rat crocidolite asbestos decreases expression ISO Apcdd1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of APCDD1 mRNA CTD PMID:29279043 Apcdd1 Rat dexamethasone multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in increased expression of APCDD1 mRNA more ... CTD PMID:16054899 and PMID:28242765 Apcdd1 Rat dexamethasone multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of APCDD1 mRNA more ... CTD PMID:28242765 and PMID:28628672 Apcdd1 Rat dexamethasone increases expression ISO APCDD1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of APCDD1 mRNA CTD PMID:25047013 Apcdd1 Rat disodium selenite decreases expression ISO APCDD1 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of APCDD1 mRNA CTD PMID:18175754 Apcdd1 Rat dorsomorphin multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Apcdd1 Rat doxorubicin affects expression ISO APCDD1 (Homo sapiens) 6480464 Doxorubicin affects the expression of APCDD1 mRNA CTD PMID:29803840 Apcdd1 Rat entinostat increases expression ISO APCDD1 (Homo sapiens) 6480464 entinostat results in increased expression of APCDD1 mRNA CTD PMID:27188386 Apcdd1 Rat ethanol affects expression ISO Apcdd1 (Mus musculus) 6480464 Ethanol affects the expression of APCDD1 mRNA CTD PMID:30319688 Apcdd1 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of APCDD1 mRNA CTD PMID:37156404 Apcdd1 Rat folic acid multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of APCDD1 mRNA CTD PMID:20938992 Apcdd1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of APCDD1 mRNA CTD PMID:33387578 Apcdd1 Rat indometacin multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of APCDD1 mRNA more ... CTD PMID:28628672 Apcdd1 Rat iron dichloride decreases expression ISO APCDD1 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of APCDD1 mRNA CTD PMID:35984750 Apcdd1 Rat L-methionine multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of APCDD1 mRNA CTD PMID:20938992 Apcdd1 Rat lipopolysaccharide multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of APCDD1 mRNA CTD PMID:35811015 Apcdd1 Rat mercury dibromide decreases expression ISO APCDD1 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of APCDD1 mRNA CTD PMID:26272509 Apcdd1 Rat mercury dibromide multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of APCDD1 mRNA CTD PMID:27188386 Apcdd1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of APCDD1 gene CTD PMID:35440735 Apcdd1 Rat methylmercury chloride increases expression ISO APCDD1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of APCDD1 mRNA CTD PMID:26272509 Apcdd1 Rat methylmercury chloride decreases expression ISO APCDD1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of APCDD1 mRNA CTD PMID:28001369 Apcdd1 Rat N-methyl-4-phenylpyridinium increases expression ISO APCDD1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of APCDD1 mRNA CTD PMID:24810058 Apcdd1 Rat okadaic acid increases expression ISO APCDD1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of APCDD1 mRNA CTD PMID:38832940 Apcdd1 Rat organophosphorus compound multiple interactions EXP 6480464 [Dust results in increased abundance of Organophosphorus Compounds] which results in increased expression of APCDD1 mRNA CTD PMID:39658253 Apcdd1 Rat ozone multiple interactions ISO Apcdd1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of APCDD1 mRNA CTD PMID:34911549 Apcdd1 Rat p-chloromercuribenzoic acid decreases expression ISO APCDD1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of APCDD1 mRNA CTD PMID:26272509 Apcdd1 Rat p-chloromercuribenzoic acid multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of APCDD1 mRNA CTD PMID:27188386 Apcdd1 Rat paracetamol affects expression ISO Apcdd1 (Mus musculus) 6480464 Acetaminophen affects the expression of APCDD1 mRNA CTD PMID:17562736 Apcdd1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of APCDD1 mRNA CTD PMID:33387578 Apcdd1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of APCDD1 mRNA CTD PMID:35163327 Apcdd1 Rat phenformin increases expression EXP 6480464 Phenformin results in increased expression of APCDD1 mRNA CTD PMID:31324951 Apcdd1 Rat progesterone increases expression ISO APCDD1 (Homo sapiens) 6480464 Progesterone results in increased expression of APCDD1 mRNA CTD PMID:20864642 Apcdd1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of APCDD1 mRNA CTD PMID:28374803 Apcdd1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of APCDD1 mRNA CTD PMID:35811015 Apcdd1 Rat SB 431542 multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Apcdd1 Rat sodium arsenate multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of APCDD1 mRNA CTD PMID:32525701 Apcdd1 Rat sodium arsenite increases expression ISO APCDD1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of APCDD1 mRNA CTD PMID:34032870 Apcdd1 Rat sulforaphane decreases expression ISO APCDD1 (Homo sapiens) 6480464 sulforaphane results in decreased expression of APCDD1 mRNA CTD PMID:31838189 Apcdd1 Rat sunitinib decreases expression ISO APCDD1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of APCDD1 mRNA CTD PMID:31533062 Apcdd1 Rat tetrachloromethane increases expression ISO Apcdd1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of APCDD1 mRNA CTD PMID:17484886 Apcdd1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of APCDD1 mRNA] CTD PMID:31150632 Apcdd1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of APCDD1 mRNA CTD PMID:31150632 Apcdd1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of APCDD1 mRNA CTD PMID:34492290 Apcdd1 Rat titanium dioxide decreases expression ISO Apcdd1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of APCDD1 mRNA CTD PMID:23557971 Apcdd1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of APCDD1 mRNA CTD PMID:22967744 Apcdd1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of APCDD1 mRNA CTD PMID:33387578 Apcdd1 Rat trichostatin A increases expression ISO APCDD1 (Homo sapiens) 6480464 trichostatin A results in increased expression of APCDD1 mRNA CTD PMID:24935251 Apcdd1 Rat valproic acid increases expression ISO Apcdd1 (Mus musculus) 6480464 Valproic Acid results in increased expression of APCDD1 mRNA CTD PMID:21427059 Apcdd1 Rat valproic acid affects expression ISO APCDD1 (Homo sapiens) 6480464 Valproic Acid affects the expression of APCDD1 mRNA CTD PMID:25979313 Apcdd1 Rat valproic acid decreases methylation ISO APCDD1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of APCDD1 gene CTD PMID:29154799 Apcdd1 Rat valproic acid multiple interactions ISO APCDD1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of APCDD1 mRNA CTD PMID:27188386 Apcdd1 Rat valproic acid increases expression ISO APCDD1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of APCDD1 mRNA CTD PMID:23179753 more ... Apcdd1 Rat valproic acid decreases expression ISO APCDD1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of APCDD1 mRNA CTD PMID:28001369
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (ISO) 1-nitropyrene (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-diaminotoluene (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) calcitriol (ISO) carbamazepine (ISO) choline (ISO) clobetasol (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) dexamethasone (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (ISO) fentin chloride (EXP) folic acid (ISO) gentamycin (EXP) indometacin (ISO) iron dichloride (ISO) L-methionine (ISO) lipopolysaccharide (ISO) mercury dibromide (ISO) methoxychlor (EXP) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) okadaic acid (ISO) organophosphorus compound (EXP) ozone (ISO) p-chloromercuribenzoic acid (ISO) paracetamol (EXP,ISO) perfluorooctanoic acid (EXP) phenformin (EXP) progesterone (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulforaphane (ISO) sunitinib (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO)
Apcdd1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 58,655,696 - 58,686,359 (+) NCBI GRCr8 mRatBN7.2 18 56,385,398 - 56,416,065 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 56,385,264 - 56,416,070 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 18 58,270,398 - 58,300,982 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 58,270,410 - 58,301,002 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 57,494,395 - 57,523,899 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 59,088,709 - 59,091,205 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 54,532,957 - 54,563,430 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
APCDD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 10,454,635 - 10,489,949 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 10,454,635 - 10,489,949 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 10,454,632 - 10,489,946 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 10,444,625 - 10,478,694 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 10,444,624 - 10,478,692 NCBI Celera 18 10,337,906 - 10,371,983 (+) NCBI Celera Cytogenetic Map 18 p11.22 NCBI HuRef 18 10,384,075 - 10,449,491 (+) NCBI HuRef CHM1_1 18 10,454,080 - 10,487,921 (+) NCBI CHM1_1 T2T-CHM13v2.0 18 10,616,628 - 10,652,095 (+) NCBI T2T-CHM13v2.0
Apcdd1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 63,055,398 - 63,086,886 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 63,055,302 - 63,094,250 (+) Ensembl GRCm39 Ensembl GRCm38 18 62,922,327 - 62,953,815 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 62,922,231 - 62,961,179 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 63,081,981 - 63,112,849 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 63,047,268 - 63,081,347 (+) NCBI MGSCv36 mm8 Celera 18 64,198,888 - 64,230,228 (+) NCBI Celera Cytogenetic Map 18 E1 NCBI cM Map 18 35.95 NCBI
Apcdd1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 1,930,037 - 1,947,765 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 1,932,685 - 1,947,680 (-) NCBI ChiLan1.0 ChiLan1.0
APCDD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 27,964,444 - 27,998,335 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 13,657,039 - 13,690,930 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 3,799,425 - 3,834,557 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 6,083,649 - 6,117,276 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 6,083,649 - 6,117,276 (-) Ensembl panpan1.1 panPan2
APCDD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 76,336,502 - 76,368,695 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 76,336,547 - 76,367,267 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 75,740,632 - 75,772,090 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 76,392,764 - 76,424,240 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 76,392,562 - 76,423,223 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 76,091,150 - 76,122,611 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 76,119,370 - 76,149,800 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 76,423,530 - 76,454,975 (+) NCBI UU_Cfam_GSD_1.0
Apcdd1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 1,988,024 - 2,066,514 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936626 1,216,323 - 1,237,792 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936626 1,217,240 - 1,237,741 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
APCDD1
APCDD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 69,283,352 - 69,317,504 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 69,283,650 - 69,318,393 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 44,258,169 - 44,292,411 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Apcdd1
.
Predicted Target Of
Count of predictions: 24 Count of miRNA genes: 21 Interacting mature miRNAs: 24 Transcripts: ENSRNOT00000067554 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331730 Scl27 Serum cholesterol level QTL 27 3.826 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 18 52292875 59796643 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1331736 Bp227 Blood pressure QTL 227 2.791 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 46718763 59796643 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61360 Eaey Experimental allergic encephalomyelitis QTL y 3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 18 46988939 60377753 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 1331806 Bp229 Blood pressure QTL 229 4.36484 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 57867167 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 1331780 Bp238 Blood pressure QTL 238 3.269 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 59796643 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6903345 Bp349 Blood pressure QTL 349 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 6903349 Bp351 Blood pressure QTL 351 3.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 6903351 Bp352 Blood pressure QTL 352 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
AU015601
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 56,386,796 - 56,387,024 (+) MAPPER mRatBN7.2 Rnor_6.0 18 58,271,507 - 58,271,734 NCBI Rnor6.0 Rnor_5.0 18 57,495,504 - 57,495,731 UniSTS Rnor5.0 Celera 18 54,534,065 - 54,534,292 UniSTS Cytogenetic Map 18 q12.1 UniSTS
BI291322
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 56,391,951 - 56,392,156 (+) MAPPER mRatBN7.2 Rnor_6.0 18 58,276,662 - 58,276,866 NCBI Rnor6.0 Rnor_5.0 18 57,500,659 - 57,500,863 UniSTS Rnor5.0 Celera 18 54,539,220 - 54,539,424 UniSTS RH 3.4 Map 18 571.7 UniSTS Cytogenetic Map 18 q12.1 UniSTS
RH137284
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 56,415,659 - 56,415,843 (+) MAPPER mRatBN7.2 Rnor_6.0 18 58,300,577 - 58,300,760 NCBI Rnor6.0 Rnor_5.0 18 57,523,494 - 57,523,677 UniSTS Rnor5.0 RGSC_v3.4 18 59,092,710 - 59,092,893 UniSTS RGSC3.4 Celera 18 54,563,025 - 54,563,208 UniSTS RH 3.4 Map 18 555.1 UniSTS Cytogenetic Map 18 q12.1 UniSTS
RH140582
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 56,414,943 - 56,415,138 (+) MAPPER mRatBN7.2 Rnor_6.0 18 58,299,861 - 58,300,055 NCBI Rnor6.0 Rnor_5.0 18 57,522,778 - 57,522,972 UniSTS Rnor5.0 Celera 18 54,562,309 - 54,562,503 UniSTS RH 3.4 Map 18 555.1 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067554 ⟹ ENSRNOP00000059242
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 56,385,264 - 56,416,070 (+) Ensembl Rnor_6.0 Ensembl 18 58,270,410 - 58,301,002 (+) Ensembl
RefSeq Acc Id:
XM_001071384 ⟹ XP_001071384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 58,655,696 - 58,686,359 (+) NCBI mRatBN7.2 18 56,385,398 - 56,416,065 (+) NCBI Rnor_6.0 18 58,270,398 - 58,300,982 (+) NCBI Rnor_5.0 18 57,494,395 - 57,523,899 (+) NCBI RGSC_v3.4 18 59,088,709 - 59,091,205 (+) RGD
Sequence:
CGCCCCGCAGCGGAGTGGCCCGCGCGCGCGATCGCGGGGGACCGAGACGAACTACAACGAGGCCCGGAGGAAACCAGAGATGTCCCGTGTGCGCCGCCTTCTGCTCGGATACCTGTTCCCAGCCCTTC
hide sequence
RefSeq Acc Id:
XP_001071384 ⟸ XM_001071384
- Sequence:
MSRVRRLLLGYLFPALLLHGLGEGSALLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYNNNTFKAYQFYYGSNRCTNPTYTLIIRGKI
hide sequence
Ensembl Acc Id:
ENSRNOP00000059242 ⟸ ENSRNOT00000067554
RGD ID: 13700825 Promoter ID: EPDNEW_R11349 Type: single initiation site Name: Apcdd1_1 Description: APC down-regulated 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 58,270,413 - 58,270,473 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-01
Apcdd1
APC down-regulated 1
Apcdd1
adenomatosis polyposis coli down-regulated 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-05-24
Apcdd1
adenomatosis polyposis coli down-regulated 1
LOC682861
similar to adenomatosis polyposis coli down-regulated 1
Data merged from RGD:1593987
1643240 APPROVED
2008-03-06
Apcdd1
adenomatosis polyposis coli down-regulated 1
LOC689616
similar to adenomatosis polyposis coli down-regulated 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC689616
similar to adenomatosis polyposis coli down-regulated 1
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-20
LOC682861
similar to adenomatosis polyposis coli down-regulated 1
Symbol and Name status set to provisional
70820 PROVISIONAL
