Advanced Search (OLGA)

Gene: Ptpmt1 (protein tyrosine phosphatase, mitochondrial 1) Rattus norvegicus

Analyze

Symbol:

Ptpmt1

Name:

protein tyrosine phosphatase, mitochondrial 1

RGD ID:

1589783

Description:

Predicted to enable phosphatidylglycerophosphatase activity; phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity; and phosphatidylinositol-5-phosphate phosphatase activity. Involved in negative regulation of insulin secretion involved in cellular response to glucose stimulus. Located in mitochondrial inner membrane. Orthologous to human PTPMT1 (protein tyrosine phosphatase mitochondrial 1); PARTICIPATES IN cardiolipin biosynthetic pathway; glycerophospholipid metabolic pathway; inositol metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC29390; LOC29390; phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1; Plip; protein tyrosine phosphatase, mitochondrial 1 (mapped); protein-tyrosine phosphatase mitochondrial 1; PTEN-like phosphatase; Ptpmt1_mapped

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,345,752 - 97,355,396 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	97,345,752 - 97,355,254 (-)	Ensembl				GRCr8
mRatBN7.2	3	76,889,922 - 76,899,427 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,889,922 - 76,899,427 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	80,367,654 - 80,377,111 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	88,966,135 - 88,975,592 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,817,507 - 86,826,976 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,734,961 - 79,743,737 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,734,961 - 79,743,737 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	86,444,081 - 86,452,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	75,269,658 - 75,279,872 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	76,098,941 - 76,108,482 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Neurodevelopmental disorder with ataxia and brain abnormalities (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,4-dihydrocoumarin (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

aniline (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

Brodifacoum (EXP)

carbon nanotube (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

doxorubicin (ISO)

flutamide (EXP)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

lead(0) (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (EXP)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenacetin (EXP)

phenylhydrazine (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

propiconazole (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

sulfasalazine (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

tetracycline (ISO)

thiram (ISO)

trichloroethene (EXP)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cardiolipin biosynthetic process (IEA,ISO,ISS)

lipid metabolic process (IEA)

mitochondrial fragmentation involved in apoptotic process (IEA,ISO,ISS)

negative regulation of insulin secretion involved in cellular response to glucose stimulus (IMP)

phosphatidylglycerol biosynthetic process (IEA)

phospholipid biosynthetic process (IEA)

regulation of intrinsic apoptotic signaling pathway (IEA,ISO)

Cellular Component

cytoplasm (IEA)

mitochondrial inner membrane (IDA,IEA,ISO)

mitochondrion (IBA,IEA,ISO)

Molecular Function

hydrolase activity (IEA)

phosphatidylglycerophosphatase activity (IBA,IEA,ISO,ISS)

phosphatidylinositol-5-phosphate phosphatase activity (IBA,ISO)

phosphoprotein phosphatase activity (IEA)

protein binding (ISO)

protein serine/threonine phosphatase activity (IEA)

protein tyrosine phosphatase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cardiolipin biosynthetic pathway (ISO)

glycerophospholipid metabolic pathway (ISO)

inositol metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
2.	Pharmacological targeting of the mitochondrial phosphatase PTPMT1.	Doughty-Shenton D, etal., J Pharmacol Exp Ther. 2010 May;333(2):584-92. doi: 10.1124/jpet.109.163329. Epub 2010 Feb 18.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	A PTEN-like phosphatase with a novel substrate specificity.	Pagliarini DJ, etal., J Biol Chem 2004 Sep 10;279(37):38590-6. Epub 2004 Jul 09.
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	Dual specificity phosphatases 18 and 21 target to opposing sides of the mitochondrial inner membrane.	Rardin MJ, etal., J Biol Chem. 2008 May 30;283(22):15440-50. doi: 10.1074/jbc.M709547200. Epub 2008 Apr 2.
7.	Metabolism and function of mitochondrial cardiolipin.	Ren M, etal., Prog Lipid Res. 2014 Jul;55:1-16. doi: 10.1016/j.plipres.2014.04.001. Epub 2014 Apr 24.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:15057822	PMID:16039589	PMID:18614015	PMID:21630459	PMID:21641550	PMID:24709986	PMID:37154493

Genomics

Comparative Map Data

Ptpmt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,345,752 - 97,355,396 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	97,345,752 - 97,355,254 (-)	Ensembl				GRCr8
mRatBN7.2	3	76,889,922 - 76,899,427 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,889,922 - 76,899,427 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	80,367,654 - 80,377,111 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	88,966,135 - 88,975,592 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,817,507 - 86,826,976 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,734,961 - 79,743,737 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,734,961 - 79,743,737 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	86,444,081 - 86,452,749 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	75,269,658 - 75,279,872 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	76,098,941 - 76,108,482 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

PTPMT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	47,565,599 - 47,573,461 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	47,565,430 - 47,573,461 (+)	Ensembl			hg38	GRCh38
GRCh37	11	47,587,151 - 47,595,013 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	47,543,705 - 47,549,946 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	11	47,729,717 - 47,737,744 (+)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	47,287,796 - 47,295,963 (+)	NCBI		HuRef
CHM1_1	11	47,586,226 - 47,594,256 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	47,726,025 - 47,733,883 (+)	NCBI		T2T-CHM13v2.0

Ptpmt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	90,741,057 - 90,748,395 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	90,739,060 - 90,748,389 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	90,910,713 - 90,918,050 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	90,908,716 - 90,918,258 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	90,750,870 - 90,758,207 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	90,711,565 - 90,718,868 (-)	NCBI		MGSCv36	mm8
Celera	2	92,295,185 - 92,302,523 (-)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	50.44	NCBI

Ptpmt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955422	723,236 - 724,761 (-)	NCBI	ChiLan1.0	ChiLan1.0

PTPMT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	49,769,875 - 49,776,265 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	49,789,677 - 49,796,026 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	47,515,304 - 47,521,529 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	48,064,931 - 48,071,832 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	48,064,931 - 48,073,474 (+)	Ensembl			panPan2	panpan1.1

PTPMT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	42,081,414 - 42,087,435 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	42,081,262 - 42,087,423 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	40,812,739 - 40,818,561 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	42,737,284 - 42,743,123 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	42,733,781 - 42,743,317 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	42,224,513 - 42,230,365 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	41,778,827 - 41,784,640 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	42,508,874 - 42,514,697 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ptpmt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	19,568,539 - 19,577,371 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	1,680,164 - 1,690,062 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	1,680,131 - 1,689,125 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PTPMT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	15,043,613 - 15,052,831 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	15,044,432 - 15,052,815 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	16,220,995 - 16,226,534 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PTPMT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	17,747,371 - 17,754,358 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	17,747,380 - 17,754,161 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	115,038,876 - 115,047,033 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ptpmt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	1,248,608 - 1,253,262 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624767	1,248,638 - 1,253,255 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ptpmt1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	65,082,485 - 65,091,490 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ptpmt1
34 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	259
Count of miRNA genes:	174
Interacting mature miRNAs:	200
Transcripts:	ENSRNOT00000013584
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

AA963126

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,889,976 - 76,890,188 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,735,016 - 79,735,227	NCBI	Rnor6.0
Rnor_5.0	3	86,444,136 - 86,444,347	UniSTS	Rnor5.0
RGSC_v3.4	3	75,269,713 - 75,269,924	UniSTS	RGSC3.4
Celera	3	76,098,996 - 76,099,207	UniSTS
Cytogenetic Map	3	q24	UniSTS

RH144148

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,893,901 - 76,894,022 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,738,939 - 79,739,059	NCBI	Rnor6.0
Rnor_5.0	3	86,448,059 - 86,448,179	UniSTS	Rnor5.0
RGSC_v3.4	3	75,274,666 - 75,274,786	UniSTS	RGSC3.4
Celera	3	76,103,021 - 76,103,141	UniSTS
Cytogenetic Map	3	q24	UniSTS

BG378525

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,889,954 - 76,890,114 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,734,994 - 79,735,153	NCBI	Rnor6.0
Rnor_5.0	3	86,444,114 - 86,444,273	UniSTS	Rnor5.0
RGSC_v3.4	3	75,269,691 - 75,269,850	UniSTS	RGSC3.4
Celera	3	76,098,974 - 76,099,133	UniSTS
RH 3.4 Map	7	811.2	UniSTS
Cytogenetic Map	3	q24	UniSTS

UniSTS:495313

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	76,898,951 - 76,899,885 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	79,743,262 - 79,744,195	NCBI	Rnor6.0
Rnor_5.0	3	86,452,274 - 86,453,207	UniSTS	Rnor5.0
RGSC_v3.4	3	75,279,397 - 75,280,330	UniSTS	RGSC3.4
Celera	3	76,108,007 - 76,108,940	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283201	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013584 ⟹ ENSRNOP00000013584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	97,345,752 - 97,355,254 (-)	Ensembl
mRatBN7.2 Ensembl	3	76,889,922 - 76,899,427 (-)	Ensembl
Rnor_6.0 Ensembl	3	79,734,961 - 79,743,737 (-)	Ensembl

RefSeq Acc Id:

NM_001105726 ⟹ NP_001099196

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,345,752 - 97,355,254 (-)	NCBI
mRatBN7.2	3	76,889,922 - 76,899,427 (-)	NCBI
Rnor_6.0	3	79,734,961 - 79,743,737 (-)	NCBI
Rnor_5.0	3	86,444,081 - 86,452,749 (-)	NCBI
RGSC_v3.4	3	75,269,658 - 75,279,872 (-)	RGD
Celera	3	76,098,941 - 76,108,482 (-)	RGD

Sequence:

show sequence

TTTTGAGACAGGGTTTCTTTGTGTGCCTTGGCTGTTCTGGAACTAGCTACATAGCCAGTAGAAG
GTAGTTTGGGCTACATAGTGTGATCTGGTCTCAAAAAAAGTTAAGAGAGAGACAGAGAGACAGA
CAGACAGTAGACTACCACTTATGTTCAGGTTCCCTGCACCCCCAAGAGCAGCAGCTCCGGTCAA
CTACGCTCCTCTTACGCCCAGATGAGGGTCCTCCGGTTCCTCCCCTGTTTAGAGGAGCCTCACT
GCTCAGCCTCCTCCTTGGTAATGGGTGCACTCGGGGGCCACGGCCCCTCCCTGAGGTCAGGGGT
TGGAGAGCAGGCCCTGCTCCTTAGGCAGGGTCACAGTTTCACCCTATCGTTGCCGTTCTACTCT
CCCTACCCCACCCCTCGCGGCGCCTCTCCTTTGGAGCCATGGTTCCTGTCCCGGGATCCCCCGG
GCCTGCCTCTGACGGCGGGGACTCAGCTTCGGAGAGTCGGGAGGCATCAGGTGGCCCGCAGCTC
TCGTCCTCTGCGTCCTTCTCGCGGTGGCTGACCGCGAGCTCCGAAGCGGGTGGCTGGCCGCTGC
GCTTGGCGGGGTGGGGCGGGATGGCGGCGTCCGCGTGGCTGGAGGCCGGCCTGGCCCGGGTGCT
CTTCTACCCGACGCTGCTCTACACAGTGTTCCGGGGGAGGGTGGGCGGCCCGGCGCACCGCGAT
TGGTACCACCGCATCGACCACACAGTGCTGCTGGGCGCGCTGCCGCTGAGGAGCATGACGCGCC
GGCTGGTACTGGACGAGAACGTGCGCGGAGTGATCACTATGAACGAGGAGTACGAGACCAGATT
CCTGTGCAACACCTCGAAGGAATGGAAGAATGTGGGAGTTGAGCAGCTACGGCTCAGCACAGTC
GACATGACTGGAGTCCCCACCTTGGCCAACCTCCACAGAGGAGTCCAGTTTGCTCTCAAGTACC
AGTCCCTGGGCCAGTGTGTCTACGTGCATTGTAAGGCTGGTCGATCCAGAAGTGCCACAATGGT
GGCAGCCTATCTGATTCAGGTACACAACTGGAGCCCAGAGGAGGCTATAGAAGCTATCGCCAAA
ATCCGGTCACACATCTCCATCAGGCCCAGCCAGTTGGAAATTCTCAAAGAGTTCCACAAGGAGA
TTGCTGCAAGGGCAGCAAAGAACTAACTACTGGTCTCTTGTGCTGACATGAGTATGAAGTCTGT
GGATGACAAAGAACTTGGCTCTCCGAGATACAGTAACATGTTAAAGGACAAAGCGCTTAAGCCA
CCACCACTGCAAATGTGCTGAGTATAATGTCCCTCCTTTGCCTTCCTTCCTGAAATAACACTTG
GATGGCCACAGAGAACAAGATTGTCTGGCGAAATCTTATTTTCTTTGACAGAGATAAGGAATAC
TAACTTTAACAGAAATCTATTGTGTTTCTGGTATATGTGATGTAAAGCAAAGCATTTAATGCTA
GAAAAGGGAAGAAGAGCATAGATCTGTTCTTTGTTACTGTCAGATCCAAATTTTAATTGTATGA
CTTGGCAAAATGCTTGCCCAGCATGTATAAGGTCTCGAATTTGGTCCCTAGCAGTTCCAAAAAT
AAAAATAAAAATAATCTTACTTCCCTGGT

hide sequence

RefSeq Acc Id:

XM_039104436 ⟹ XP_038960364

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,345,762 - 97,354,912 (-)	NCBI
mRatBN7.2	3	76,889,924 - 76,899,097 (-)	NCBI

RefSeq Acc Id:

XM_039104437 ⟹ XP_038960365

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,345,762 - 97,355,332 (-)	NCBI
mRatBN7.2	3	76,889,924 - 76,899,321 (-)	NCBI

RefSeq Acc Id:

XM_039104438 ⟹ XP_038960366

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,350,122 - 97,354,921 (-)	NCBI
mRatBN7.2	3	76,894,294 - 76,899,104 (-)	NCBI

RefSeq Acc Id:

XM_039104439 ⟹ XP_038960367

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,350,076 - 97,355,396 (-)	NCBI
mRatBN7.2	3	76,894,252 - 76,899,378 (-)	NCBI

RefSeq Acc Id:

XM_063283200 ⟹ XP_063139270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,345,762 - 97,355,200 (-)	NCBI

RefSeq Acc Id:

XM_063283201 ⟹ XP_063139271

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,350,076 - 97,354,923 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099196	(Get FASTA)	NCBI Sequence Viewer
	XP_038960364	(Get FASTA)	NCBI Sequence Viewer
	XP_038960365	(Get FASTA)	NCBI Sequence Viewer
	XP_038960366	(Get FASTA)	NCBI Sequence Viewer
	XP_038960367	(Get FASTA)	NCBI Sequence Viewer
	XP_063139270	(Get FASTA)	NCBI Sequence Viewer
	XP_063139271	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79493	(Get FASTA)	NCBI Sequence Viewer
	EDL79494	(Get FASTA)	NCBI Sequence Viewer
	EDL79495	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013584
GenBank Protein	P0C089	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001099196 ⟸ NM_001105726

- UniProtKB:

G3V7B6 (UniProtKB/TrEMBL), A6HN92 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVPVPGSPGPASDGGDSASESREASGGPQLSSSASFSRWLTASSEAGGWPLRLAGWGGMAASAW
LEAGLARVLFYPTLLYTVFRGRVGGPAHRDWYHRIDHTVLLGALPLRSMTRRLVLDENVRGVIT
MNEEYETRFLCNTSKEWKNVGVEQLRLSTVDMTGVPTLANLHRGVQFALKYQSLGQCVYVHCKA
GRSRSATMVAAYLIQVHNWSPEEAIEAIAKIRSHISIRPSQLEILKEFHKEIAARAAKN

hide sequence

Ensembl Acc Id:

ENSRNOP00000013584 ⟸ ENSRNOT00000013584

RefSeq Acc Id:	XP_038960365 ⟸ XM_039104437
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038960364 ⟸ XM_039104436
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038960367 ⟸ XM_039104439
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038960366 ⟸ XM_039104438
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063139270 ⟸ XM_063283200
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063139271 ⟸ XM_063283201
- Peptide Label:	isoform X4

Protein Domains

Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P0C089-F1-model_v2	AlphaFold	P0C089	1-193	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692202

Promoter ID:

EPDNEW_R2727

Type:

initiation region

Name:

Ptpmt1_1

Description:

protein tyrosine phosphatase, mitochondrial 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	79,743,344 - 79,743,404	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1589783	AgrOrtholog
BioCyc Gene	G2FUF-48757	BioCyc
BioCyc Pathway	PWY-5269 [cardiolipin biosynthesis II]	BioCyc
	PWY4FS-8 [phosphatidylglycerol biosynthesis II (non-plastidic)]	BioCyc
BioCyc Pathway Image	PWY-5269	BioCyc
	PWY4FS-8	BioCyc
Ensembl Genes	ENSRNOG00000009723	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013584	ENTREZGENE
Gene3D-CATH	3.90.190.10	UniProtKB/Swiss-Prot
InterPro	Dual-sp_phosphatase_cat-dom	UniProtKB/Swiss-Prot
	Prot-tyrosine_phosphatase-like	UniProtKB/Swiss-Prot
	PTPMT1	UniProtKB/Swiss-Prot
	PTPMT1-like	UniProtKB/Swiss-Prot
	Tyr_Pase_AS	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_dom	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/Swiss-Prot
NCBI Gene	29390	ENTREZGENE
PANTHER	PHOSPHATIDYLGLYCEROPHOSPHATASE AND PROTEIN-TYROSINE PHOSPHATASE 1	UniProtKB/Swiss-Prot
	PTHR46712	UniProtKB/Swiss-Prot
Pfam	DSPc	UniProtKB/Swiss-Prot
PhenoGen	Ptpmt1	PhenoGen
PROSITE	TYR_PHOSPHATASE_1	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_2	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009723	RatGTEx
SMART	DSPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52799	UniProtKB/Swiss-Prot
UniProt	A6HN92	ENTREZGENE, UniProtKB/TrEMBL
	A6HN93_RAT	UniProtKB/TrEMBL
	A6HN94_RAT	UniProtKB/TrEMBL
	G3V7B6	ENTREZGENE, UniProtKB/TrEMBL
	P0C089	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2007-04-13	Ptpmt1	protein tyrosine phosphatase, mitochondrial 1	Ptpmt1_mapped	protein tyrosine phosphatase, mitochondrial 1 (mapped)	Data merged from RGD:735045	737654	APPROVED
2006-11-20	Ptpmt1_mapped	protein tyrosine phosphatase, mitochondrial 1(mapped)	Ptpmt1	protein tyrosine phosphatase, mitochondrial 1	Symbol set to symbol_mapped, name set to name (mapped)	1582166	APPROVED
2006-11-20	Ptpmt1	protein tyrosine phosphatase, mitochondrial 1			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-30	Ptpmt1	protein tyrosine phosphatase, mitochondrial 1	Plip	PTEN-like phosphatase	Symbol and Name updated	1299863	APPROVED
2005-07-08	Plip	PTEN-like phosphatase	LOC29390	hypothetical protein LOC29390	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways