Advanced Search (OLGA)

Gene: Pou5f2 (POU domain class 5, transcription factor 2) Rattus norvegicus

Analyze

Symbol:

Pou5f2

Name:

POU domain class 5, transcription factor 2

RGD ID:

1589456

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Orthologous to human POU5F2 (POU domain class 5, transcription factor 2); INTERACTS WITH ammonium chloride; bisphenol A; tributylstannane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC679507; LOC680620; POU domain, class 5, transcription factor 2; similar to Sperm 1 POU-domain transcription factor (SPRM-1); sperm 1 POU domain transcription factor; sperm 1 POU-domain transcription factor; sperm-associated POU domain protein 1; Sprm-1; Sprm1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	9,643,313 - 9,644,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	2	7,907,504 - 7,908,738 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	2	15,023,353 - 15,024,587 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	13,122,653 - 13,123,887 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	7,771,517 - 7,772,751 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	5,437,067 - 5,438,301 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	5,437,067 - 5,438,301 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	5,416,352 - 5,417,586 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	5,621,260 - 5,622,494 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	4,358,043 - 4,359,277 (+)	NCBI		Celera
Cytogenetic Map	2	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol AF (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

dibutyl phthalate (ISO)

disodium selenite (ISO)

epoxiconazole (ISO)

folic acid (ISO)

mestranol (ISO)

ozone (ISO)

PCB138 (ISO)

permethrin (ISO)

quercitrin (ISO)

resveratrol (ISO)

titanium dioxide (ISO)

tributylstannane (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

meiotic cell cycle (IEA)

regulation of DNA-templated transcription (IEA)

regulation of transcription by RNA polymerase II (IBA)

spermatogenesis (IEA)

Cellular Component

nucleus (IEA)

Molecular Function

DNA binding (IEA)

DNA-binding transcription factor activity (IEA)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7902581	PMID:15057822

Genomics

Comparative Map Data

Pou5f2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	9,643,313 - 9,644,547 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	2	7,907,504 - 7,908,738 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	2	15,023,353 - 15,024,587 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	13,122,653 - 13,123,887 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	7,771,517 - 7,772,751 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	5,437,067 - 5,438,301 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	5,437,067 - 5,438,301 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	5,416,352 - 5,417,586 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	5,621,260 - 5,622,494 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	4,358,043 - 4,359,277 (+)	NCBI		Celera
Cytogenetic Map	2	q11	NCBI

POU5F2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	93,733,220 - 93,741,600 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	93,733,220 - 93,741,600 (-)	Ensembl			hg38	GRCh38
GRCh37	5	93,068,926 - 93,077,306 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	93,101,771 - 93,103,065 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	5	88,936,192 - 88,937,486 (-)	NCBI		Celera
Cytogenetic Map	5	q15	NCBI
HuRef	5	88,248,986 - 88,250,280 (-)	NCBI		HuRef
CHM1_1	5	92,508,680 - 92,509,974 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	94,217,284 - 94,225,664 (-)	NCBI		T2T-CHM13v2.0

Pou5f2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	78,173,021 - 78,174,415 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	78,173,021 - 78,174,414 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	78,024,902 - 78,026,296 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	78,024,902 - 78,026,295 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	78,164,163 - 78,165,557 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	78,488,449 - 78,489,843 (+)	NCBI		MGSCv36	mm8
Celera	13	80,312,747 - 80,314,141 (+)	NCBI		Celera
Cytogenetic Map	13	C1	NCBI
cM Map	13	41.38	NCBI

Pou5f2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955418	18,493,622 - 18,494,871 (+)	NCBI	ChiLan1.0	ChiLan1.0

POU5F2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	21,648,987 - 21,673,579 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	19,802,372 - 19,819,581 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	21,624,172 - 21,627,395 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	21,763,167 - 21,764,466 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	21,763,211 - 21,764,197 (+)	Ensembl			panPan2	panpan1.1

Pou5f2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	171,176,053 - 171,177,601 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936523	9,361,749 - 9,362,814 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936523	9,360,876 - 9,363,054 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POU5F2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	100,602,508 - 100,624,006 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	104,251,887 - 104,260,866 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POU5F2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	87,625,754 - 87,629,124 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	87,626,124 - 87,627,110 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666049	36,823,658 - 36,827,148 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pou5f2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	12,619,864 - 12,620,899 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624743	12,619,216 - 12,621,258 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Pou5f2
6 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578664	Bmd9	Bone mineral QTL density 9	5		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	5736325	50736325	Rat
738010	Lnnr3	Liver neoplastic nodule remodeling QTL 3	2.94		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	2	1	42977529	Rat
9590080	Insglur4	Insulin/glucose ratio QTL 4	28.7	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	2	6152767	51152767	Rat
1600379	Mcs18	Mammary carcinoma susceptibility QTL 18	2.6		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	44538110	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
731166	Mamtr2	Mammary tumor resistance QTL 2		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	54623581	Rat
61368	Mcs1	Mammary carcinoma susceptibility QTL 1	4.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	9623581	25054526	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat

Markers in Region

PMC123630P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	7,907,992 - 7,908,642 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	5,437,556 - 5,438,205	NCBI	Rnor6.0
Rnor_5.0	2	5,416,841 - 5,417,490	UniSTS	Rnor5.0
RGSC_v3.4	2	5,621,749 - 5,622,398	UniSTS	RGSC3.4
Celera	2	4,358,532 - 4,359,181	UniSTS
Cytogenetic Map	2	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	1	21	94	38	35	24	44	24	4	139	80	8	85	30	36	11	12	12

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001081751	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099302	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L23864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000093516 ⟹ ENSRNOP00000076140

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	5,437,067 - 5,438,301 (+)	Ensembl

RefSeq Acc Id:

NM_001081751 ⟹ NP_001075220

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	9,643,313 - 9,644,547 (+)	NCBI
mRatBN7.2	2	7,907,504 - 7,908,738 (+)	NCBI
Rnor_6.0	2	5,437,067 - 5,438,301 (+)	NCBI
Rnor_5.0	2	5,416,352 - 5,417,586 (+)	NCBI
RGSC_v3.4	2	5,621,260 - 5,622,494 (+)	RGD
Celera	2	4,358,043 - 4,359,277 (+)	RGD

Sequence:

show sequence

GCCATCAGTTCCTACCAGACTCTTGCTGGGGGTCCCATCCACCCCCCATGGCCGGGCGCAGGTC
TTCAAACGTCTGCCCCTTCCCAGGCAATAGTGGTGGTGGTCTGGAAGGGCCAGTTCCCATGCGA
GTTGATACCCCAACCTGGTTGAGCAGCCAGGCAGCCACAAGCAGGTTAATGGTACGGCCAGGTA
TGGGGCCAGGCTTCTGTCCAGGCCCTGAGGTATGGGGAGTGCCTCTGGGTCCCTCACCTTATGA
ATTCCGAGGTGGGATAGCACCCTACGGAGCTTATGAGACAAGGACCTGGTCCCAGAATTCCTCT
GAGGATACCTACCCAGGACCCTACATCGCCTTAAGGTACATGCCAAATTTGGCACTGCCAGAGG
ATGTTTCAGCCATACAGAAAGAGATGGAGCAGCTGGCCAAGGAGCTGAGACAGAAGAGGATGAC
CCTGGGATACTCACAGGCCGATGTGGGATTCGCTGTGGGAGCTATGTTTGGGAAGGTTCTCAGC
CAGACGACCATATGCCGCTTCGAGGCCCAGCAGCTCAGCCTTGCCAACATGTGGAAGCTGCGAC
CCCTGCTGAAAATGTGGTTAGAGGAAGTAGATGAGAAGAACCTTCTGGGCATATCGAGAATGGA
GATGATCCTGCAGCAGGCCCGGAAGCGGAGACGAGCAAGCAGAGAGAGACGCATTGGGAGCAAT
CTGGAAAAACTGTTCTTGCAGTGTCCAGAGCCTACGCCCCAGCAAATCAGCTATATTGCTGGGC
GCCTCCGTCTGCAGAAGGACTTGGTCCAAGTGTGGTTTTCTAACCGGAGCCAGATGGCTGGTTG
GCCAACCAATGATTCCTCCCAGAGGGAGAATGTGGGGGCAACTGGGGCCCCTTTCCCAGGGCCA
CCAGTGTGCTTTCCCCTGGCACCAGGGCTCCATTTTGATTTCCCCCACTATGGGGGGTCATGTC
TTACACCCCTGTACTCCTCTACACCATTTCCTGTACGAGGAGCCCTTTTGTCTGCCCCAACCAC
CACCCTGGGCCTTCCCAGGCTGTCAAGCTGAGGGGCCTACCCTGGAGGAAATGAGAGAATAGAG
AGCAGGGGCTTTTTTTTCGGGTTTGTGTTCAGTTCTCTGACTTAGTGAGGGTGGGAGTGGTTTA
CAGAAGCTTGGGGAGGAAGTTAAAGCTGCTTTTTGTTTCTACCTTTGTTTATCCCTGGTGGTAG
CATTACAATATATTTATG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001075220	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	P56225	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001075220 ⟸ NM_001081751

- UniProtKB:

P56225 (UniProtKB/Swiss-Prot), A6I4H3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGRRSSNVCPFPGNSGGGLEGPVPMRVDTPTWLSSQAATSRLMVRPGMGPGFCPGPEVWGVPL
GPSPYEFRGGIAPYGAYETRTWSQNSSEDTYPGPYIALRYMPNLALPEDVSAIQKEMEQLAKEL
RQKRMTLGYSQADVGFAVGAMFGKVLSQTTICRFEAQQLSLANMWKLRPLLKMWLEEVDEKNLL
GISRMEMILQQARKRRRASRERRIGSNLEKLFLQCPEPTPQQISYIAGRLRLQKDLVQVWFSNR
SQMAGWPTNDSSQRENVGATGAPFPGPPVCFPLAPGLHFDFPHYGGSCLTPLYSSTPFPVRGAL
LSAPTTTLGLPRLSS

hide sequence

Ensembl Acc Id:

ENSRNOP00000076140 ⟸ ENSRNOT00000093516

Protein Domains

Homeobox POU-specific

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P56225-F1-model_v2	AlphaFold	P56225	1-335	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1589456	AgrOrtholog
BioCyc Gene	G2FUF-55063	BioCyc
Ensembl Genes	ENSRNOG00000062285	Ensembl
Gene3D-CATH	1.10.260.40	UniProtKB/Swiss-Prot
	Homeodomain-like	UniProtKB/Swiss-Prot
InterPro	Homeobox-like_sf	UniProtKB/Swiss-Prot
	Homeobox_dom	UniProtKB/Swiss-Prot
	Lambda_DNA-bd_dom_sf	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
	POU_dom	UniProtKB/Swiss-Prot
	POU_domain_TF	UniProtKB/Swiss-Prot
NCBI Gene	680620	ENTREZGENE
PANTHER	POU DOMAIN	UniProtKB/Swiss-Prot
	PTHR11636:SF14	UniProtKB/Swiss-Prot
Pfam	Homeodomain	UniProtKB/Swiss-Prot
	Pou	UniProtKB/Swiss-Prot
PhenoGen	Pou5f2	PhenoGen
PRINTS	POUDOMAIN	UniProtKB/Swiss-Prot
PROSITE	HOMEOBOX_2	UniProtKB/Swiss-Prot
	POU_1	UniProtKB/Swiss-Prot
	POU_2	UniProtKB/Swiss-Prot
	POU_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000062285	RatGTEx
SMART	HOX	UniProtKB/Swiss-Prot
	POU	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46689	UniProtKB/Swiss-Prot
	SSF47413	UniProtKB/Swiss-Prot
UniProt	A6I4H3	ENTREZGENE, UniProtKB/TrEMBL
	P56225	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Pou5f2	POU domain class 5, transcription factor 2	Sprm1	sperm-associated POU domain protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-03-14	Sprm1	sperm-associated POU domain protein 1	LOC680620	similar to Sperm 1 POU-domain transcription factor (SPRM-1)	Symbol and Name updated	1299863	APPROVED
2007-02-06	LOC680620	similar to Sperm 1 POU-domain transcription factor (SPRM-1)	LOC679507	similar to Sperm 1 POU-domain transcription factor (SPRM-1)	Data merged from RGD:1587176	737654	PROVISIONAL
2006-11-19	LOC680620	similar to Sperm 1 POU-domain transcription factor (SPRM-1)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message