Advanced Search (OLGA)

Gene: Ccl26 (C-C motif chemokine ligand 26) Rattus norvegicus

Analyze

Symbol:

Ccl26

Name:

C-C motif chemokine ligand 26

RGD ID:

1587817

Description:

Predicted to enable CCR3 chemokine receptor binding activity; CX3C chemokine receptor binding activity; and chemokine activity. Predicted to be involved in several processes, including leukocyte chemotaxis; positive regulation of actin filament polymerization; and positive regulation of endothelial cell proliferation. Predicted to be located in extracellular space. Used to study asthma. Human ortholog(s) of this gene implicated in asthma; eosinophilic esophagitis; and rhinitis. Orthologous to human CCL26 (C-C motif chemokine ligand 26); PARTICIPATES IN interleukin-4 signaling pathway; chemokine mediated signaling pathway; INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; 1-nitropyrene (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-C motif chemokine 26; chemokine (C-C motif) ligand 26; LOC685958; similar to eotaxin 3-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCL26 (C-C motif chemokine ligand 26)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ccl26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccl26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCL26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCL26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccl26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCL26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCL26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccl26 (C-C motif chemokine ligand 26)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CCL26 (C-C motif chemokine ligand 26)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CCL26 (C-C motif chemokine ligand 26)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccl26 (C-C motif chemokine ligand 26)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccl26 (C-C motif chemokine ligand 26)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,745,972 - 26,750,924 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	12	21,109,384 - 21,114,336 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,109,421 - 21,114,335 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	22,251,193 - 22,256,123 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,863,537 - 22,868,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,930,001 - 21,934,931 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,157,182 - 24,161,870 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,158,766 - 24,161,869 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	26,154,496 - 26,159,229 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	22,265,430 - 22,268,793 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	22,873,373 - 22,876,736 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic asthma (ISO)

allergic rhinitis (ISO)

asthma (IDA,ISO)

atopic dermatitis (ISO)

bullous pemphigoid (ISO)

Churg-Strauss syndrome (ISO)

coronary artery disease (ISO)

Eosinophilia (ISO)

Eosinophilic Asthma (ISO)

eosinophilic esophagitis (ISO)

eosinophilic gastroenteritis (ISO)

Eosinophilic Pustular Folliculitis (ISO)

gastroesophageal reflux disease (ISO)

Nasal Polyps (ISO)

primary cutaneous T-cell non-Hodgkin lymphoma (ISO)

rhinitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-nitropyrene (ISO)

2-hydroxypropanoic acid (ISO)

6-propyl-2-thiouracil (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

cannabidiol (ISO)

carbamazepine (ISO)

ceric oxide (ISO)

chloropicrin (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crotonaldehyde (ISO)

dexamethasone (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

disulfiram (ISO)

dorsomorphin (ISO)

emodin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

folic acid (ISO)

fragrance (ISO)

hydrogen peroxide (ISO)

lead diacetate (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methylisothiazolinone (ISO)

nickel atom (ISO)

okadaic acid (ISO)

panobinostat (ISO)

pentanal (ISO)

propanal (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

thiram (ISO)

trichostatin A (ISO)

U-73122 (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell chemotaxis (ISO)

chemokine-mediated signaling pathway (ISO)

monocyte chemotaxis (ISO)

positive regulation of actin filament polymerization (ISO)

positive regulation of cell migration (ISO)

positive regulation of chemotaxis (ISO)

positive regulation of endothelial cell proliferation (ISO)

T cell chemotaxis (ISO)

Cellular Component

extracellular space (ISO)

Molecular Function

CCR3 chemokine receptor binding (ISO)

chemokine activity (ISO)

CX3C chemokine receptor binding (ISO)

receptor ligand activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

interleukin-4 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Comparison of the nasal release of IL-4, IL-10, IL-17, CCL13/MCP-4, and CCL26/eotaxin-3 in allergic rhinitis during season and after allergen challenge.	Baumann R, etal., Am J Rhinol Allergy. 2013 Jul-Aug;27(4):266-72. doi: 10.2500/ajra.2013.27.3913.
2.	Increased expression of eotaxin-3 distinguishes between eosinophilic esophagitis and gastroesophageal reflux disease.	Bhattacharya B, etal., Hum Pathol. 2007 Dec;38(12):1744-53. Epub 2007 Sep 27.
3.	Histologic eosinophilic gastritis is a systemic disorder associated with blood and extragastric eosinophilia, TH2 immunity, and a unique gastric transcriptome.	Caldwell JM, etal., J Allergy Clin Immunol. 2014 Nov;134(5):1114-24. doi: 10.1016/j.jaci.2014.07.026. Epub 2014 Sep 15.
4.	Analysis of the polymorphisms in eotaxin gene family and their association with asthma, IgE, and eosinophil.	Chae SC, etal., Biochem Biophys Res Commun. 2004 Jul 16;320(1):131-7.
5.	The suggestive association of eotaxin-2 and eotaxin-3 gene polymorphisms in Korean population with allergic rhinitis.	Chae SC, etal., Immunogenetics. 2005 Jan;56(10):760-4. Epub 2004 Dec 4.
6.	Nasal fluid release of eotaxin-3 and eotaxin-2 in persistent sinonasal eosinophilic inflammation.	De Corso E, etal., Int Forum Allergy Rhinol. 2014 Aug;4(8):617-24. doi: 10.1002/alr.21348. Epub 2014 Jul 2.
7.	Markers of eosinophilic inflammation and risk prediction in patients with coronary artery disease.	Falcone C, etal., Eur J Clin Invest. 2006 Apr;36(4):211-7.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps.	Gu Z, etal., J Otolaryngol Head Neck Surg. 2011 Feb;40(1):64-9.
10.	AcCystatin, an immunoregulatory molecule from Angiostrongylus cantonensis, ameliorates the asthmatic response in an aluminium hydroxide/ovalbumin-induced rat model of asthma.	Ji P, etal., Parasitol Res. 2015 Feb;114(2):613-24. doi: 10.1007/s00436-014-4223-z. Epub 2014 Nov 18.
11.	Significant elevation of serum levels of eotaxin-3/CCL26, but not of eotaxin-2/CCL24, in patients with atopic dermatitis: serum eotaxin-3/CCL26 levels reflect the disease activity of atopic dermatitis.	Kagami S, etal., Clin Exp Immunol. 2003 Nov;134(2):309-13.
12.	High levels of CCL26 in blister fluid and sera of patients with bullous pemphigoid.	Kagami S, etal., J Invest Dermatol. 2012 Jan;132(1):249-51. doi: 10.1038/jid.2011.251. Epub 2011 Sep 1.
13.	Eotaxin-3 and interleukin-5 pleural fluid levels are associated with pleural fluid eosinophilia in post-coronary artery bypass grafting pleural effusions.	Kalomenidis I, etal., Chest. 2005 Jun;127(6):2094-100.
14.	Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma.	Larose MC, etal., J Allergy Clin Immunol. 2015 Oct;136(4):904-13. doi: 10.1016/j.jaci.2015.02.039. Epub 2015 May 1.
15.	Genetic interactions model among Eotaxin gene polymorphisms in asthma.	Lee JH, etal., J Hum Genet. 2008;53(10):867-75. Epub 2008 Aug 20.
16.	Treatment with topical steroids downregulates IL-5, eotaxin-1/CCL11, and eotaxin-3/CCL26 gene expression in eosinophilic esophagitis.	Lucendo AJ, etal., Am J Gastroenterol. 2008 Sep;103(9):2184-93. doi: 10.1111/j.1572-0241.2008.01937.x.
17.	Comparison of plasma eotaxin family level in aspirin-induced and aspirin-tolerant asthma patients.	Min JW, etal., Chest. 2005 Nov;128(5):3127-32.
18.	Eotaxins and CCR3 interaction regulates the Th2 environment of cutaneous T-cell lymphoma.	Miyagaki T, etal., J Invest Dermatol. 2010 Sep;130(9):2304-11. doi: 10.1038/jid.2010.128. Epub 2010 May 27.
19.	PGD2 induces eotaxin-3 via PPARgamma from sebocytes: a possible pathogenesis of eosinophilic pustular folliculitis.	Nakahigashi K, etal., J Allergy Clin Immunol. 2012 Feb;129(2):536-43. doi: 10.1016/j.jaci.2011.11.034. Epub 2011 Dec 28.
20.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
21.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Comprehensive gene review and curation	RGD comprehensive gene curation
24.	Mucosal cytokine profiles in paediatric eosinophilic oesophagitis: a case-control study.	Romano C, etal., Dig Liver Dis. 2014 Jul;46(7):590-5. doi: 10.1016/j.dld.2014.03.003. Epub 2014 Apr 3.
25.	Puerarin attenuates airway inflammation by regulation of eotaxin-3.	Wang J, etal., Immunol Lett. 2015 Feb;163(2):173-8. doi: 10.1016/j.imlet.2014.12.002. Epub 2014 Dec 19.
26.	Eotaxin-1, -2, and -3 immunoreactivity and protein concentration in the nasal polyps of eosinophilic chronic rhinosinusitis patients.	Yao T, etal., Laryngoscope. 2009 Jun;119(6):1053-9.
27.	Eotaxin-3 in Churg-Strauss syndrome: a clinical and immunogenetic study.	Zwerina J, etal., Rheumatology (Oxford). 2011 Oct;50(10):1823-7. doi: 10.1093/rheumatology/keq445. Epub 2011 Jan 25.

Additional References at PubMed

PMID:10373330	PMID:11425309	PMID:19525930	PMID:31151084

Genomics

Comparative Map Data

Ccl26
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	26,745,972 - 26,750,924 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	12	21,109,384 - 21,114,336 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,109,421 - 21,114,335 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	22,251,193 - 22,256,123 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	22,863,537 - 22,868,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	21,930,001 - 21,934,931 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,157,182 - 24,161,870 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,158,766 - 24,161,869 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	26,154,496 - 26,159,229 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	22,265,430 - 22,268,793 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	22,873,373 - 22,876,736 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

CCL26
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	75,769,524 - 75,791,597 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	75,769,533 - 75,789,896 (-)	Ensembl			hg38	GRCh38
GRCh37	7	75,398,842 - 75,420,915 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	75,236,778 - 75,257,000 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	75,043,492 - 75,063,715	NCBI
Celera	7	70,266,590 - 70,286,812 (-)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	70,484,790 - 70,505,408 (-)	NCBI		HuRef
CHM1_1	7	75,328,822 - 75,349,108 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	77,056,596 - 77,078,673 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	74,731,906 - 74,752,128 (-)	NCBI

Ccl26
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,589,302 - 135,592,423 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,589,302 - 135,592,423 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	135,560,448 - 135,563,569 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,560,448 - 135,563,569 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	136,036,318 - 136,039,439 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,845,075 - 135,848,196 (-)	NCBI		MGSCv36	mm8
Celera	5	132,571,981 - 132,575,102 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	75.27	NCBI

Ccl26
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955456	14,554,583 - 14,558,967 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCL26
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	94,180,602 - 94,184,888 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	142,445,240 - 142,449,526 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	68,230,804 - 68,251,369 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	82,221,846 - 82,242,874 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	82,221,846 - 82,242,874 (-)	Ensembl			panPan2	panpan1.1

CCL26
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	7,151,352 - 7,154,509 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	7,151,212 - 7,154,726 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,848,112 - 8,851,272 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,971,954 - 6,975,124 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,971,814 - 6,981,222 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,941,498 - 6,944,666 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,904,900 - 6,908,069 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	7,068,177 - 7,071,344 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccl26
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,619,608 - 131,626,877 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,414,850 - 2,416,953 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,414,948 - 2,416,922 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCL26
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	10,381,306 - 10,385,677 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	10,381,306 - 10,385,677 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CCL26
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	10,036,177 - 10,038,962 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	10,036,337 - 10,038,875 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	6,400,433 - 6,403,167 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccl26
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	18,455,804 - 18,458,870 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccl26
111 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	123
Count of miRNA genes:	98
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000001963
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
11530002	Bss119	Bone structure and strength QTL 119	16.39	4e-17	lumbar vertebra area (VT:0010570)	lumbar vertebra area (CMO:0001688)	12	26510038	26983303	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

BF390551

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,114,097 - 21,114,257 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,161,632 - 24,161,791	NCBI	Rnor6.0
Rnor_5.0	12	26,158,935 - 26,159,094	UniSTS	Rnor5.0
RGSC_v3.4	12	22,268,556 - 22,268,715	UniSTS	RGSC3.4
Celera	12	22,876,499 - 22,876,658	UniSTS
RH 3.4 Map	12	340.51	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
2	4	9	26	41	35	21	12	21	1	75	37	1	12	13	35	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001963 ⟹ ENSRNOP00000001963

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	21,109,421 - 21,114,335 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,158,766 - 24,161,869 (+)	Ensembl

RefSeq Acc Id:

NM_001109488 ⟹ NP_001102958

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	26,745,972 - 26,750,924 (+)	NCBI
mRatBN7.2	12	21,109,384 - 21,114,336 (+)	NCBI
Rnor_6.0	12	24,158,766 - 24,161,869 (+)	NCBI
Rnor_5.0	12	26,154,496 - 26,159,229 (+)	NCBI
RGSC_v3.4	12	22,265,430 - 22,268,793 (+)	RGD
Celera	12	22,873,373 - 22,876,736 (+)	RGD

Sequence:

show sequence

AGACTCAGAGAAGACAAACCAGGAGGAGCTGAGGAGCCATCTATAAAGGGCCCGGGTGAATGGA
CCATGAAGACCTTCTCTTTAGGTCCCATTGTTCTCCTGGCCGTCTTCCTCAGTGTCCAGCTTGG
TGTTGCCACGTGTGAGAGTGAAATGCCCATGCCCTGCTGTTCCTATTTCAGCCACTACGTGATC
CCGTGGCACTGGCTGTACAGCTACCAGATCACCGACAGCTCCTGCCCCAATGAGGGCGTCATAT
TCACCACAAAAACTGGTAAGCAATACTGTGTCCAGCCAGGGGACAAGTGGGTGCAGAGATACAT
TTCCTTGTTGAACGCCAAGAAGCATTGGTGACCCCGCTGAATTTTCGGCCCGAGGACCATTCAA
TGCAGCTCTCGGCTCCTTTGCGCTCATGGAATCTGGTGCATTGCTTTAAAGACTTCGCAGCCCT
GCTGGAAGGAGAGCGTGGTTTTCATTGCAGATTTTTAAATAAAGATTTGATTTCAATAGGTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102958	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM13366	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102958 ⟸ NM_001109488
- Peptide Label:	precursor
- UniProtKB:	A6J0C7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKTFSLGPIVLLAVFLSVQLGVATCESEMPMPCCSYFSHYVIPWHWLYSYQITDSSCPNEGVIF TTKTGKQYCVQPGDKWVQRYISLLNAKKHW hide sequence

Ensembl Acc Id:

ENSRNOP00000001963 ⟸ ENSRNOT00000001963

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQG2-F1-model_v2	AlphaFold	D3ZQG2	1-94	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1587817	AgrOrtholog
BioCyc Gene	G2FUF-19625	BioCyc
Ensembl Genes	ENSRNOG00000001444	Ensembl
Gene3D-CATH	2.40.50.40	UniProtKB/TrEMBL
InterPro	Chemokine_b/g/d	UniProtKB/TrEMBL
	Chemokine_IL8	UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:685958	UniProtKB/TrEMBL
NCBI Gene	685958	ENTREZGENE
PANTHER	C-C MOTIF CHEMOKINE 26	UniProtKB/TrEMBL
	PTHR12015	UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/TrEMBL
PhenoGen	Ccl26	PhenoGen
RatGTEx	ENSRNOG00000001444	RatGTEx
SMART	SCY	UniProtKB/TrEMBL
Superfamily-SCOP	Chemokine_IL8	UniProtKB/TrEMBL
UniProt	A6J0C7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Ccl26	C-C motif chemokine ligand 26	Ccl26	chemokine (C-C motif) ligand 26	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Ccl26	chemokine (C-C motif) ligand 26	LOC687177	similar to eotaxin 3-like	Data merged from RGD:1588909	1643240	APPROVED
2008-06-27			Ccl26	chemokine (C-C motif) ligand 26	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Ccl26	chemokine (C-C motif) ligand 26	LOC685958	similar to eotaxin 3-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC685958	similar to eotaxin 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687177	similar to eotaxin 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)