Cpne2 (copine 2) - Rat Genome Database

Name: Cpne2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cpne2 (copine 2) Rattus norvegicus

Analyze

Symbol:

Cpne2

Name:

copine 2

RGD ID:

1586036

Description:

Predicted to enable calcium-dependent phospholipid binding activity. Predicted to be involved in cellular response to calcium ion. Predicted to be located in cytoplasm and nucleus. Predicted to be active in plasma membrane. Orthologous to human CPNE2 (copine 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

copine II; copine-2; LOC498972; LOC689288; similar to copine II

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CPNE2 (copine 2)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Cpne2 (copine II)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cpne2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CPNE2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CPNE2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cpne2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CPNE2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CPNE2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cpne2 (copine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RABGGTA (Rab geranylgeranyltransferase subunit alpha)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CPNE2 (copine 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cpne2 (copine II)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cpne2 (copine II)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gem-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nra-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,440,245 - 10,477,783 (-)	NCBI		GRCr8
mRatBN7.2	19	10,434,277 - 10,472,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,434,277 - 10,471,820 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,397,954 - 10,420,348 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,164,809 - 11,187,203 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,451,764 - 10,474,163 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,860,963 - 10,898,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,861,406 - 10,884,047 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,855,268 - 10,877,311 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,876,907 - 10,885,628 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	10,323,757 - 10,345,868 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bardet-Biedl syndrome (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

diazinon (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

fenthion (ISO)

gentamycin (EXP)

ivermectin (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methidathion (ISO)

monosodium L-glutamate (ISO)

N-methyl-4-phenylpyridinium (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

succimer (ISO)

sunitinib (ISO)

tamoxifen (ISO)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to calcium ion (IBA,ISO)

Cellular Component

clathrin-coated endocytic vesicle (ISO)

cytoplasm (ISO)

nucleus (ISO)

plasma membrane (IBA,ISO)

Molecular Function

calcium-dependent phospholipid binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:21087455	PMID:23533145

Genomics

Comparative Map Data

Cpne2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,440,245 - 10,477,783 (-)	NCBI		GRCr8
mRatBN7.2	19	10,434,277 - 10,472,146 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,434,277 - 10,471,820 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,397,954 - 10,420,348 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	11,164,809 - 11,187,203 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,451,764 - 10,474,163 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,860,963 - 10,898,970 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,861,406 - 10,884,047 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,855,268 - 10,877,311 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,876,907 - 10,885,628 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	10,323,757 - 10,345,868 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

CPNE2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	57,092,583 - 57,148,369 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	57,092,583 - 57,148,369 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	57,126,495 - 57,182,281 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	55,684,011 - 55,739,377 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	55,684,010 - 55,739,377	NCBI
Celera	16	41,626,325 - 41,681,691 (+)	NCBI		Celera
Cytogenetic Map	16	q13	NCBI
HuRef	16	42,996,323 - 43,051,749 (+)	NCBI		HuRef
CHM1_1	16	58,533,918 - 58,589,365 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	62,888,853 - 62,944,643 (+)	NCBI		T2T-CHM13v2.0

Cpne2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,259,299 - 95,297,157 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,259,618 - 95,297,159 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,532,674 - 94,570,529 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,532,990 - 94,570,531 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,056,928 - 97,094,429 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,422,157 - 97,459,658 (+)	NCBI		MGSCv36	mm8
Celera	8	98,866,664 - 98,904,195 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.55	NCBI

Cpne2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	14,769,798 - 14,808,916 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	14,766,247 - 14,808,916 (+)	NCBI	ChiLan1.0	ChiLan1.0

CPNE2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	66,564,565 - 66,620,380 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	72,485,349 - 72,541,164 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	37,369,694 - 37,426,177 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	56,517,092 - 56,558,834 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	56,517,092 - 56,558,834 (+)	Ensembl	panpan1.1		panPan2

CPNE2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	59,226,410 - 59,257,170 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	59,226,410 - 59,259,900 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	55,854,566 - 55,900,418 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	59,764,707 - 59,810,534 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	59,764,707 - 59,810,641 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	56,595,980 - 56,641,808 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	57,603,332 - 57,649,143 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	58,497,441 - 58,543,263 (-)	NCBI		UU_Cfam_GSD_1.0

Cpne2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	50,326,487 - 50,351,161 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	9,226,572 - 9,262,856 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	9,237,845 - 9,262,588 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPNE2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	19,046,795 - 19,096,107 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	19,046,795 - 19,096,111 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CPNE2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	43,043,433 - 43,100,132 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	43,062,679 - 43,101,872 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	33,220,085 - 33,275,880 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpne2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	28,903,773 - 28,931,489 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	28,903,915 - 28,946,597 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cpne2
268 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	44
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000063791
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10323180	23069265	Rat

Markers in Region

D19Rat37

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	19	10,955,228 - 10,955,438	NCBI	Rnor6.0
RGSC_v3.4	19	10,953,018 - 10,953,415	UniSTS	RGSC3.4
Celera	19	10,407,271 - 10,407,470	UniSTS
RH 3.4 Map	19	96.02	UniSTS
RH 3.4 Map	19	96.02	RGD
RH 2.0 Map	19	153.0	RGD
SHRSP x BN Map	19	6.7498	RGD
Cytogenetic Map	19	p12	UniSTS

D19Rat79

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,532,990 - 10,533,122 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,975,632 - 10,975,763	NCBI	Rnor6.0
Rnor_5.0	19	10,958,601 - 10,958,732	UniSTS	Rnor5.0
RGSC_v3.4	19	10,965,620 - 10,965,880	RGD	RGSC3.4
RGSC_v3.4	19	10,965,679 - 10,965,810	UniSTS	RGSC3.4
RGSC_v3.1	19	10,970,505 - 10,970,636	RGD
Celera	19	10,420,606 - 10,420,737	UniSTS
RH 3.4 Map	19	99.8	RGD
RH 3.4 Map	19	99.8	UniSTS
RH 2.0 Map	19	102.3	RGD
SHRSP x BN Map	19	6.7498	RGD
Cytogenetic Map	19	p12	UniSTS

STS-F03992

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,434,521 - 10,434,602 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,861,208 - 10,861,288	NCBI	Rnor6.0
Rnor_5.0	19	10,855,070 - 10,855,150	UniSTS	Rnor5.0
RGSC_v3.4	19	10,877,491 - 10,877,571	UniSTS	RGSC3.4
Celera	19	10,323,559 - 10,323,639	UniSTS
Cytogenetic Map	19	p12	UniSTS

PMC26527P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	9,758,010 - 9,758,216 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,173,739 - 10,173,944	NCBI	Rnor6.0
Rnor_6.0	19	10,958,680 - 10,958,885	NCBI	Rnor6.0
Rnor_5.0	19	10,942,666 - 10,942,871	UniSTS	Rnor5.0
Rnor_5.0	19	10,157,245 - 10,157,450	UniSTS	Rnor5.0
RGSC_v3.4	19	10,223,978 - 10,224,183	UniSTS	RGSC3.4
Celera	19	9,650,538 - 9,650,743	UniSTS
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	19	p13	UniSTS

RH132440

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,434,367 - 10,434,558 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,861,054 - 10,861,244	NCBI	Rnor6.0
Rnor_5.0	19	10,854,916 - 10,855,106	UniSTS	Rnor5.0
RGSC_v3.4	19	10,877,337 - 10,877,527	UniSTS	RGSC3.4
Celera	19	10,323,405 - 10,323,595	UniSTS
RH 3.4 Map	19	97.1	UniSTS
Cytogenetic Map	19	p12	UniSTS

AA997159

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,451,447 - 10,451,557 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,878,330 - 10,878,439	NCBI	Rnor6.0
Rnor_5.0	19	10,871,594 - 10,871,703	UniSTS	Rnor5.0
Celera	19	10,340,359 - 10,340,468	UniSTS
RH 3.4 Map	19	97.1	UniSTS

RH138953

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	9,758,568 - 9,758,699 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,959,238 - 10,959,368	NCBI	Rnor6.0
Rnor_6.0	19	10,174,297 - 10,174,427	NCBI	Rnor6.0
Rnor_5.0	19	10,157,803 - 10,157,933	UniSTS	Rnor5.0
Rnor_5.0	19	10,943,224 - 10,943,354	UniSTS	Rnor5.0
RGSC_v3.4	19	10,224,536 - 10,224,666	UniSTS	RGSC3.4
Celera	19	9,651,096 - 9,651,226	UniSTS
RH 3.4 Map	19	94.41	UniSTS
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	19	p13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			12	4	6	4			48	16	30	11
Low	3	43	45	37	13	37	8	11	26	19	11		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001256466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010060019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AM747280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000063791 ⟹ ENSRNOP00000063507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,434,277 - 10,471,820 (-)	Ensembl
Rnor_6.0 Ensembl	19	10,861,409 - 10,884,047 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000088196 ⟹ ENSRNOP00000071480

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,434,277 - 10,471,820 (-)	Ensembl
Rnor_6.0 Ensembl	19	10,861,406 - 10,884,047 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096281 ⟹ ENSRNOP00000092273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,434,277 - 10,458,194 (-)	Ensembl

RefSeq Acc Id:

NM_001256466 ⟹ NP_001243395

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	10,440,245 - 10,477,783 (-)	NCBI
mRatBN7.2	19	10,434,277 - 10,471,820 (-)	NCBI
Rnor_6.0	19	10,861,406 - 10,884,047 (-)	NCBI
Rnor_5.0	19	10,855,268 - 10,877,311 (-)	NCBI
Celera	19	10,323,757 - 10,345,868 (-)	NCBI

Sequence:

show sequence

ATGGCCTACATTCCGGATGGGGGCCCTCCCACTGCAGGGGGCATCCCCTTGGGTTCTCAGTGCT
GTGTGTGCAAAGTGGAGCTGTCAGTGAGTGGCCAGAACCTGCTGGACCGGGACGTCACCTCCAA
GTCTGACCCTTTCTGTGTCCTCTTTATAGAGGACAACGGCAGGTGGATGGAGTTCGACAGAACA
GAAACAGCCATCAACAACCTCAACCCGGCCTTCTCTAAGAAGTTTGTGCTGGACTACCACTTCG
AGGAGGTGCAGAAGCTCAAGTTCGCTCTGTTTGACCAGGACAAGTCCAGTGCACAGTTGGATGA
GCATGACTTCCTGGGCCAGTTCTCCTGCAGCCTTGGCACGATTGTCTCCAGCAAGAAGATCACT
AGGCCTCTGCTGCTGATGAATGACAAGCCTGCAGGGAAGGGCTTAATCACGATCGCAGCCCAAG
AGCTGTCAGACAACCGGGTCATCACACTGAGCCTGGCCGGCCGGAAGCTGGATAAGAAGGACCT
CTTTGGGAAATCAGACCCGTTCCTTGAGTTTTATAAGCCGGGAGATGACGGCAAGTGGATGTTG
GTCCACAGGACTGAGGTGATTAAGTACACCCTGGATCCTGTATGGAAACCATTCACTGTACCGT
TGGTATCCTTGTGTGATGGTGACCTGGAGAAGCCCATCCAGGTTATGTGCTACGACTATGACAA
TAATGGAGGTCATGACTTCATCGGCGAGTTCCAGACCTCTGTGTTGCAGATGAGCGAGGCTCGG
GATGGTGTCCCGCTGGAGATGGAGTGCATCAATCCCAAGAAGCAGAGGAAGAAGAAAAGCTACA
AGAACTCGGGCATCATTATTCTGAGATCATGCAAGATACACCGAAACTACTCATTCCTGGATTA
TATTCTGGGAGGCTGCCAGCTCATGTTCACCGTTGGAATAGACTTCACAGCCTCCAACGGGAAT
CCCCTCGACCCTTCTTCTCTCCATTATATCAACCCCATGGGCACCAATGAATATTTGTCAGCCA
TCTGGGCAGTGGGACAGATCATTCAGGACTATGACAGTGATAAGATGTTCCCTGCTCTGGGGTT
TGGGGCCCAGTTACCCCCGGACTGGAAGGTGTCCCATGAGTTCGCTATCAACTTCAACCCCACT
AATCCTTTCTGCTCAGGCGTGGATGGCATCGCCCAGGCGTACTCAGCCTGTCTGCCCCACATTC
GCTTCTATGGCCCCACAAACTTCTCCCCTATCGTCAACCACGTGGCCCGGTTTGCAGCCCAGGC
CACAGAGCAGCAGACAGCAACGCAGTACTTCATCCTCCTCATCATCACTGACGGGGTCATCAGT
GACATGGAGGAGACACGGCACGCCGTAGTGCAGGCCTCCAAGCTGCCCATGTCCATTATCATTG
TGGGTGTGGGCAATGCTGACTTTGCAGCCATGGAGTTTCTAGATGGGGACAACCGTAGACTGCG
CTCACATACAGGCGAGGAGGCAGCCCGGGACATTGTGCAGTTCGTGCCCTTCCGAGAGTTCCGC
AATGCAGCCAAAGAAACGCTGGCTAAAGCGGTGCTTGCAGAGCTTCCTCAGCAGGTAGTGCAGT
ATTTCAAGCATAAAAACCTGCCCCCCACCAACTCGGAGCCTGCCTGA

hide sequence

RefSeq Acc Id:

XR_010060019

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	10,442,007 - 10,462,941 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001243395	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAO00505	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063507
	ENSRNOP00000063507.4
	ENSRNOP00000071480.2
	ENSRNOP00000092273.1

RefSeq Acc Id:

NP_001243395 ⟸ NM_001256466

- UniProtKB:

H1UBM7 (UniProtKB/TrEMBL), F1M1L9 (UniProtKB/TrEMBL), A0A0G2K0K1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAYIPDGGPPTAGGIPLGSQCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRT
ETAINNLNPAFSKKFVLDYHFEEVQKLKFALFDQDKSSAQLDEHDFLGQFSCSLGTIVSSKKIT
RPLLLMNDKPAGKGLITIAAQELSDNRVITLSLAGRKLDKKDLFGKSDPFLEFYKPGDDGKWML
VHRTEVIKYTLDPVWKPFTVPLVSLCDGDLEKPIQVMCYDYDNNGGHDFIGEFQTSVLQMSEAR
DGVPLEMECINPKKQRKKKSYKNSGIIILRSCKIHRNYSFLDYILGGCQLMFTVGIDFTASNGN
PLDPSSLHYINPMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPT
NPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATEQQTATQYFILLIITDGVIS
DMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDNRRLRSHTGEEAARDIVQFVPFREFR
NAAKETLAKAVLAELPQQVVQYFKHKNLPPTNSEPA

hide sequence

RefSeq Acc Id:

ENSRNOP00000063507 ⟸ ENSRNOT00000063791

RefSeq Acc Id:

ENSRNOP00000071480 ⟸ ENSRNOT00000088196

RefSeq Acc Id:

ENSRNOP00000092273 ⟸ ENSRNOT00000096281

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M1L9-F1-model_v2	AlphaFold	F1M1L9	1-547	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1586036	AgrOrtholog
BioCyc Gene	G2FUF-6498	BioCyc
Ensembl Genes	ENSRNOG00000043286	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000063791	ENTREZGENE
	ENSRNOT00000063791.4	UniProtKB/TrEMBL
	ENSRNOT00000088196.2	UniProtKB/TrEMBL
	ENSRNOT00000096281.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.150	UniProtKB/TrEMBL
InterPro	C2_Ca-dep	UniProtKB/TrEMBL
	C2_domain_sf	UniProtKB/TrEMBL
	C2B_Copine	UniProtKB/TrEMBL
	Copine	UniProtKB/TrEMBL
	Copine	UniProtKB/TrEMBL
	VWF_A	UniProtKB/TrEMBL
	vWFA_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:498972	UniProtKB/TrEMBL
NCBI Gene	498972	ENTREZGENE
PANTHER	COPINE-2	UniProtKB/TrEMBL
	PTHR10857	UniProtKB/TrEMBL
Pfam	Copine	UniProtKB/TrEMBL
	PF00168	UniProtKB/TrEMBL
PhenoGen	Cpne2	PhenoGen
PROSITE	PS50004	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000043286	RatGTEx
SMART	SM00239	UniProtKB/TrEMBL
	VWA	UniProtKB/TrEMBL
Superfamily-SCOP	SSF49562	UniProtKB/TrEMBL
	SSF53300	UniProtKB/TrEMBL
UniProt	A0A0G2K0K1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AH83_RAT	UniProtKB/TrEMBL
	F1M1L9	ENTREZGENE, UniProtKB/TrEMBL
	H1UBM7	ENTREZGENE
UniProt Secondary	H1UBM7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-03	Cpne2	copine 2	Cpne2	copine II	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-29	Cpne2	copine II	LOC689288	similar to copine II	Data merged from RGD:1594765	737654	PROVISIONAL
2013-08-09	Cpne2	copine II	LOC498972	similar to copine II	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC689288	similar to copine II			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC498972	similar to copine II			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar